BLASTX nr result
ID: Papaver31_contig00002594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00002594 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010262037.1| PREDICTED: lycopene epsilon cyclase, chlorop... 57 5e-06 ref|XP_010262036.1| PREDICTED: lycopene epsilon cyclase, chlorop... 57 5e-06 >ref|XP_010262037.1| PREDICTED: lycopene epsilon cyclase, chloroplastic isoform X2 [Nelumbo nucifera] Length = 533 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 99 KKGFFDEEDYIKAGGSEILFVQMQQKKPMDK 7 K+ F DEEDYIKAGGSE+LFVQMQQ KPMDK Sbjct: 63 KEDFVDEEDYIKAGGSELLFVQMQQTKPMDK 93 >ref|XP_010262036.1| PREDICTED: lycopene epsilon cyclase, chloroplastic isoform X1 [Nelumbo nucifera] Length = 536 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 99 KKGFFDEEDYIKAGGSEILFVQMQQKKPMDK 7 K+ F DEEDYIKAGGSE+LFVQMQQ KPMDK Sbjct: 63 KEDFVDEEDYIKAGGSELLFVQMQQTKPMDK 93