BLASTX nr result
ID: Papaver31_contig00002135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00002135 (1189 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001239801.1| uncharacterized protein LOC100783648 [Glycin... 94 3e-16 ref|XP_010058239.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 7e-16 ref|XP_008789197.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 7e-16 ref|XP_010058233.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 7e-16 gb|AFK34102.1| unknown [Lotus japonicus] 92 7e-16 ref|XP_003554219.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 7e-16 ref|XP_011467122.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 9e-16 ref|XP_010932478.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 9e-16 emb|CBI30002.3| unnamed protein product [Vitis vinifera] 92 9e-16 gb|EMS48370.1| Thioredoxin-like 3-1, chloroplastic [Triticum ura... 92 9e-16 ref|XP_003570535.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 9e-16 dbj|BAJ86603.1| predicted protein [Hordeum vulgare subsp. vulgare] 92 9e-16 dbj|BAJ90718.1| predicted protein [Hordeum vulgare subsp. vulgare] 92 9e-16 ref|XP_002275794.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 9e-16 ref|XP_006849545.2| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 1e-15 ref|XP_012087788.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 1e-15 ref|XP_004493602.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 92 1e-15 ref|XP_011075104.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 91 1e-15 ref|XP_011039475.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 91 1e-15 gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x P... 91 1e-15 >ref|NP_001239801.1| uncharacterized protein LOC100783648 [Glycine max] gi|255640849|gb|ACU20707.1| unknown [Glycine max] gi|734332483|gb|KHN07443.1| Thioredoxin-like 3-1, chloroplastic [Glycine soja] gi|947118833|gb|KRH67082.1| hypothetical protein GLYMA_03G146000 [Glycine max] Length = 189 Score = 93.6 bits (231), Expect = 3e-16 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQLWKDGEMKEEVIGGHKAW V++E++EMIQKY+ Sbjct: 140 VPQTLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWLVIEEVKEMIQKYL 189 >ref|XP_010058239.1| PREDICTED: thioredoxin-like 3-1, chloroplastic isoform X2 [Eucalyptus grandis] Length = 194 Score = 92.4 bits (228), Expect = 7e-16 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQ+WKDGEMKEEVIGGHKAW V++E+REMI+KY+ Sbjct: 145 VPQTLVKRGNISKMPTIQVWKDGEMKEEVIGGHKAWLVIEEVREMIKKYV 194 >ref|XP_008789197.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Phoenix dactylifera] Length = 85 Score = 92.4 bits (228), Expect = 7e-16 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 VSQ LVKRGNISKMPTIQLWKDGEMK EVIGGHKAW V+DE+REMIQK I Sbjct: 36 VSQELVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVMDEVREMIQKNI 85 >ref|XP_010058233.1| PREDICTED: thioredoxin-like 3-1, chloroplastic isoform X1 [Eucalyptus grandis] gi|629125897|gb|KCW90322.1| hypothetical protein EUGRSUZ_A02464 [Eucalyptus grandis] Length = 196 Score = 92.4 bits (228), Expect = 7e-16 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQ+WKDGEMKEEVIGGHKAW V++E+REMI+KY+ Sbjct: 147 VPQTLVKRGNISKMPTIQVWKDGEMKEEVIGGHKAWLVIEEVREMIKKYV 196 >gb|AFK34102.1| unknown [Lotus japonicus] Length = 187 Score = 92.4 bits (228), Expect = 7e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQLWKDGEMKEEVIGGHK W V++E+REMIQK+I Sbjct: 138 VPQTLVKRGNISKMPTIQLWKDGEMKEEVIGGHKGWLVIEEVREMIQKFI 187 >ref|XP_003554219.1| PREDICTED: thioredoxin-like 3-1, chloroplastic-like isoform 2 [Glycine max] gi|734430194|gb|KHN45422.1| Thioredoxin-like 3-1, chloroplastic [Glycine soja] gi|947045775|gb|KRG95404.1| hypothetical protein GLYMA_19G149200 [Glycine max] Length = 188 Score = 92.4 bits (228), Expect = 7e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQLWKDGEMK EVIGGHKAW V++E+REMIQKY+ Sbjct: 139 VPQTLVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVMEEVREMIQKYL 188 >ref|XP_011467122.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Fragaria vesca subsp. vesca] Length = 185 Score = 92.0 bits (227), Expect = 9e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQ+WKDGE KEEVIGGHKAW V+DE+REMIQK++ Sbjct: 136 VPQTLVKRGNISKMPTIQVWKDGEFKEEVIGGHKAWLVIDEVREMIQKFV 185 >ref|XP_010932478.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Elaeis guineensis] Length = 187 Score = 92.0 bits (227), Expect = 9e-16 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 VSQ LVKRGNISKMPTIQLWKDGE+K EVIGGHKAW V+DE+REMIQK++ Sbjct: 138 VSQDLVKRGNISKMPTIQLWKDGELKAEVIGGHKAWLVMDEVREMIQKHV 187 >emb|CBI30002.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 92.0 bits (227), Expect = 9e-16 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 1189 SVSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 +VSQ LVKRGNI+KMPTIQLWKDGEMK EVIGGHKAW V+DE+REMI+K++ Sbjct: 63 NVSQALVKRGNITKMPTIQLWKDGEMKAEVIGGHKAWIVIDEVREMIKKFV 113 >gb|EMS48370.1| Thioredoxin-like 3-1, chloroplastic [Triticum urartu] Length = 175 Score = 92.0 bits (227), Expect = 9e-16 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKY 1040 V Q +VKRGNISKMPTIQLWKDGE KEEVIGGHKAW V+DE+REMIQKY Sbjct: 126 VPQAVVKRGNISKMPTIQLWKDGEWKEEVIGGHKAWLVMDEVREMIQKY 174 >ref|XP_003570535.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Brachypodium distachyon] gi|944066082|gb|KQK01673.1| hypothetical protein BRADI_3g57470 [Brachypodium distachyon] Length = 192 Score = 92.0 bits (227), Expect = 9e-16 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKY 1040 V Q +VKRGNISKMPTIQLWKDGE KEEVIGGHKAW V+DE+REMIQKY Sbjct: 143 VPQAVVKRGNISKMPTIQLWKDGEWKEEVIGGHKAWLVMDEVREMIQKY 191 >dbj|BAJ86603.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 186 Score = 92.0 bits (227), Expect = 9e-16 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKY 1040 V Q +VKRGNISKMPTIQLWKDGE KEEVIGGHKAW V+DE+REMIQKY Sbjct: 137 VPQAVVKRGNISKMPTIQLWKDGEWKEEVIGGHKAWLVMDEVREMIQKY 185 >dbj|BAJ90718.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 184 Score = 92.0 bits (227), Expect = 9e-16 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKY 1040 V Q +VKRGNISKMPTIQLWKDGE KEEVIGGHKAW V+DE+REMIQKY Sbjct: 135 VPQAVVKRGNISKMPTIQLWKDGEWKEEVIGGHKAWLVMDEVREMIQKY 183 >ref|XP_002275794.1| PREDICTED: thioredoxin-like 3-1, chloroplastic isoform X1 [Vitis vinifera] Length = 185 Score = 92.0 bits (227), Expect = 9e-16 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 1189 SVSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 +VSQ LVKRGNI+KMPTIQLWKDGEMK EVIGGHKAW V+DE+REMI+K++ Sbjct: 135 NVSQALVKRGNITKMPTIQLWKDGEMKAEVIGGHKAWIVIDEVREMIKKFV 185 >ref|XP_006849545.2| PREDICTED: thioredoxin-like 3-1, chloroplastic [Amborella trichopoda] Length = 196 Score = 91.7 bits (226), Expect = 1e-15 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 1189 SVSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 +V Q LVKRGNISKMPTIQLWKDGEMK EVIGGHKAW VLDE+REMI K++ Sbjct: 146 NVPQALVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVLDEVREMIHKFL 196 >ref|XP_012087788.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Jatropha curcas] gi|643710504|gb|KDP24646.1| hypothetical protein JCGZ_25562 [Jatropha curcas] Length = 191 Score = 91.7 bits (226), Expect = 1e-15 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQLWKDGEMK EVIGGHKAW V++E+REMIQK+I Sbjct: 142 VPQALVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQKFI 191 >ref|XP_004493602.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Cicer arietinum] gi|828300424|ref|XP_012569345.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Cicer arietinum] Length = 186 Score = 91.7 bits (226), Expect = 1e-15 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQLWKDGEMK EVIGGHKAW V++E+REMIQK+I Sbjct: 137 VPQTLVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQKFI 186 >ref|XP_011075104.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Sesamum indicum] Length = 185 Score = 91.3 bits (225), Expect = 1e-15 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 1189 SVSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 +VSQ LVKRGNISKMPTIQ+WKDGEMK EVIGGHKAW V++E+REMIQ+++ Sbjct: 135 NVSQALVKRGNISKMPTIQIWKDGEMKAEVIGGHKAWLVIEEVREMIQQFV 185 >ref|XP_011039475.1| PREDICTED: thioredoxin-like 3-1, chloroplastic isoform X2 [Populus euphratica] Length = 193 Score = 91.3 bits (225), Expect = 1e-15 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQLWKDGEMK EVIGGHKAW V++E+REMIQK++ Sbjct: 144 VPQALVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVMEEVREMIQKFV 193 >gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x Populus tremuloides] Length = 121 Score = 91.3 bits (225), Expect = 1e-15 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 1186 VSQVLVKRGNISKMPTIQLWKDGEMKEEVIGGHKAWQVLDEIREMIQKYI 1037 V Q LVKRGNISKMPTIQLWKDGEMK EVIGGHKAW V++E+REMIQK++ Sbjct: 72 VPQALVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQKFV 121