BLASTX nr result
ID: Papaver31_contig00001443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00001443 (645 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274036.1| PREDICTED: molybdopterin synthase sulfur car... 127 7e-27 ref|XP_012854939.1| PREDICTED: molybdopterin synthase sulfur car... 117 6e-24 ref|XP_011101556.1| PREDICTED: molybdopterin synthase sulfur car... 116 1e-23 ref|XP_014499900.1| PREDICTED: molybdopterin synthase sulfur car... 115 2e-23 ref|XP_007148669.1| hypothetical protein PHAVU_005G004900g [Phas... 115 2e-23 gb|KOM42958.1| hypothetical protein LR48_Vigan05g056200 [Vigna a... 115 2e-23 ref|NP_001238656.1| uncharacterized protein LOC100527353 [Glycin... 115 2e-23 ref|XP_012452184.1| PREDICTED: molybdopterin synthase sulfur car... 114 5e-23 ref|XP_010062364.1| PREDICTED: molybdopterin synthase sulfur car... 114 5e-23 ref|XP_004290242.1| PREDICTED: molybdopterin synthase sulfur car... 114 6e-23 ref|XP_007019912.1| Cell wall / vacuolar inhibitor of fructosida... 113 8e-23 ref|XP_002525500.1| conserved hypothetical protein [Ricinus comm... 111 3e-22 ref|XP_003598217.2| molybdopterin synthase sulfur carrier subuni... 111 3e-22 gb|KHG23145.1| hypothetical protein F383_09778 [Gossypium arboreum] 111 4e-22 ref|XP_008237751.1| PREDICTED: molybdopterin synthase sulfur car... 111 4e-22 gb|AFK46858.1| unknown [Lotus japonicus] 111 4e-22 ref|XP_004499653.1| PREDICTED: molybdopterin synthase sulfur car... 110 5e-22 gb|KNA15202.1| hypothetical protein SOVF_100510 [Spinacia oleracea] 110 7e-22 ref|XP_007200636.1| hypothetical protein PRUPE_ppa013746mg [Prun... 110 7e-22 ref|XP_006478433.1| PREDICTED: molybdopterin synthase sulfur car... 110 9e-22 >ref|XP_002274036.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vitis vinifera] gi|731436282|ref|XP_010645854.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vitis vinifera] gi|731436284|ref|XP_010645855.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vitis vinifera] gi|297740933|emb|CBI31245.3| unnamed protein product [Vitis vinifera] Length = 106 Score = 127 bits (318), Expect = 7e-27 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 2/101 (1%) Frame = -2 Query: 578 GRQGFPTMDEENK--KGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTK 405 G + T+D NK G+ V IK LFFARARDL G +++M ++VPSGSTA DCL+K+ K Sbjct: 6 GEKESQTVDSTNKGSDGSSVGIKFLFFARARDLTGGLTDMPMEVPSGSTAHDCLNKLVAK 65 Query: 404 YPQLEEIRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 +P+LEEIR CMVLA+N EY PE TVV D+DELAIIPPISGG Sbjct: 66 FPRLEEIRGCMVLALNEEYTPESTVVKDRDELAIIPPISGG 106 >ref|XP_012854939.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Erythranthe guttatus] gi|604303240|gb|EYU22713.1| hypothetical protein MIMGU_mgv1a024016mg [Erythranthe guttata] Length = 91 Score = 117 bits (293), Expect = 6e-24 Identities = 58/92 (63%), Positives = 72/92 (78%) Frame = -2 Query: 557 MDEENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRE 378 MD E ++ ++IKVLFFARARDL G +++M L+V G+TA CL K+ TK+P LEEIR Sbjct: 1 MDSEKEERISIKIKVLFFARARDLTG-MTDMSLEVSPGTTALGCLDKVITKFPGLEEIRN 59 Query: 377 CMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 CMVLA+N EY PE TVV D+DELA+IPPISGG Sbjct: 60 CMVLALNEEYTPESTVVKDRDELALIPPISGG 91 >ref|XP_011101556.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Sesamum indicum] gi|747106529|ref|XP_011101557.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Sesamum indicum] Length = 105 Score = 116 bits (290), Expect = 1e-23 Identities = 58/90 (64%), Positives = 71/90 (78%) Frame = -2 Query: 551 EENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRECM 372 +E K+ V+IKVLFFARARDL G +++ ML+V G+TA DCL+K+ K+P LEEIR CM Sbjct: 17 KEEKEDISVQIKVLFFARARDLTG-MTDTMLEVSPGTTAHDCLNKLIIKFPGLEEIRNCM 75 Query: 371 VLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 VLA+N EY PE VV D+DELAIIPPISGG Sbjct: 76 VLALNEEYTPESAVVKDRDELAIIPPISGG 105 >ref|XP_014499900.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vigna radiata var. radiata] gi|950969717|ref|XP_014499901.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vigna radiata var. radiata] gi|950969721|ref|XP_014499902.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vigna radiata var. radiata] gi|950969726|ref|XP_014499903.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vigna radiata var. radiata] Length = 102 Score = 115 bits (289), Expect = 2e-23 Identities = 62/92 (67%), Positives = 71/92 (77%), Gaps = 1/92 (1%) Frame = -2 Query: 554 DEENKKGAD-VEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRE 378 D NKK + V+IKVLFFARARDL G +SEM L+VPSGST DCL K+ K+P LEEIR Sbjct: 12 DTRNKKESSLVKIKVLFFARARDLTG-LSEMPLEVPSGSTTHDCLKKLVVKFPGLEEIRG 70 Query: 377 CMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 CMVLA+N EY E ++V D DELAIIPPISGG Sbjct: 71 CMVLALNEEYTNESSIVKDTDELAIIPPISGG 102 >ref|XP_007148669.1| hypothetical protein PHAVU_005G004900g [Phaseolus vulgaris] gi|561021933|gb|ESW20663.1| hypothetical protein PHAVU_005G004900g [Phaseolus vulgaris] Length = 103 Score = 115 bits (289), Expect = 2e-23 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 1/92 (1%) Frame = -2 Query: 554 DEENKKGAD-VEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRE 378 D NK + V+IKVLFFARARDL G +SEM L+VPSGST DCL K+F K+P LEEIR Sbjct: 13 DTPNKNQSSLVKIKVLFFARARDLTG-LSEMPLEVPSGSTTHDCLKKLFVKFPGLEEIRG 71 Query: 377 CMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 CMVLA+N EY E ++V D DELA+IPPISGG Sbjct: 72 CMVLALNEEYTTESSIVKDTDELALIPPISGG 103 >gb|KOM42958.1| hypothetical protein LR48_Vigan05g056200 [Vigna angularis] Length = 103 Score = 115 bits (288), Expect = 2e-23 Identities = 63/96 (65%), Positives = 74/96 (77%), Gaps = 4/96 (4%) Frame = -2 Query: 557 MDEE---NKKGAD-VEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLE 390 +DE+ NKK + V+IKVLFFARARDL G +SEM L+VPSGST DCL K+ K+P LE Sbjct: 9 LDEDGTRNKKESSLVKIKVLFFARARDLTG-LSEMPLEVPSGSTTHDCLKKLVVKFPDLE 67 Query: 389 EIRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 EIR CMVLA+N EY E ++V D DELAIIPPISGG Sbjct: 68 EIRGCMVLALNEEYTTESSIVKDTDELAIIPPISGG 103 >ref|NP_001238656.1| uncharacterized protein LOC100527353 [Glycine max] gi|571457939|ref|XP_006580958.1| PREDICTED: uncharacterized protein LOC100527353 isoform X1 [Glycine max] gi|571457941|ref|XP_006580959.1| PREDICTED: uncharacterized protein LOC100527353 isoform X2 [Glycine max] gi|255632153|gb|ACU16429.1| unknown [Glycine max] gi|734374030|gb|KHN20574.1| Molybdopterin synthase sulfur carrier subunit [Glycine soja] gi|947108006|gb|KRH56389.1| hypothetical protein GLYMA_06G321300 [Glycine max] gi|947108007|gb|KRH56390.1| hypothetical protein GLYMA_06G321300 [Glycine max] gi|947108008|gb|KRH56391.1| hypothetical protein GLYMA_06G321300 [Glycine max] gi|947108009|gb|KRH56392.1| hypothetical protein GLYMA_06G321300 [Glycine max] Length = 102 Score = 115 bits (288), Expect = 2e-23 Identities = 59/89 (66%), Positives = 70/89 (78%) Frame = -2 Query: 548 ENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRECMV 369 + K+ + V+IKVLFFARARDL G +SE+ L+V SGST DCL K+F K+P LEEIR CMV Sbjct: 15 KKKESSLVKIKVLFFARARDLTG-LSELPLEVSSGSTTHDCLKKLFVKFPSLEEIRGCMV 73 Query: 368 LAVNLEYVPEFTVVNDKDELAIIPPISGG 282 LA+N EY E T+V D DELAIIPPISGG Sbjct: 74 LALNEEYTTESTIVKDTDELAIIPPISGG 102 >ref|XP_012452184.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Gossypium raimondii] gi|823239051|ref|XP_012452185.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Gossypium raimondii] gi|763800761|gb|KJB67716.1| hypothetical protein B456_010G205800 [Gossypium raimondii] gi|763800762|gb|KJB67717.1| hypothetical protein B456_010G205800 [Gossypium raimondii] Length = 101 Score = 114 bits (285), Expect = 5e-23 Identities = 56/94 (59%), Positives = 73/94 (77%) Frame = -2 Query: 563 PTMDEENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEI 384 P + K G+ V+IKVLFFA+ARD+ G ++E+ ++V SGST QDCL+K+ K+P L+EI Sbjct: 9 PAVQSVVKDGSFVQIKVLFFAKARDITG-LTELSMEVSSGSTTQDCLNKLVAKFPNLDEI 67 Query: 383 RECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 R+C+VLA+N EY E VV DKDELAIIPPISGG Sbjct: 68 RQCIVLALNEEYTTESAVVKDKDELAIIPPISGG 101 >ref|XP_010062364.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Eucalyptus grandis] gi|629104026|gb|KCW69495.1| hypothetical protein EUGRSUZ_F02944 [Eucalyptus grandis] Length = 105 Score = 114 bits (285), Expect = 5e-23 Identities = 59/97 (60%), Positives = 75/97 (77%) Frame = -2 Query: 572 QGFPTMDEENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQL 393 QG P +E G+ V IKVLFFARARDL G +S++ L+VPSGSTA DCL+++ ++P L Sbjct: 14 QGIPKKEE----GSSVGIKVLFFARARDLTG-LSDVHLEVPSGSTASDCLNELAVRFPGL 68 Query: 392 EEIRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 EEIR+C+VLA+N EY E TV+ + DELAIIPPISGG Sbjct: 69 EEIRQCIVLALNEEYASETTVIKENDELAIIPPISGG 105 >ref|XP_004290242.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Fragaria vesca subsp. vesca] Length = 105 Score = 114 bits (284), Expect = 6e-23 Identities = 62/95 (65%), Positives = 73/95 (76%), Gaps = 2/95 (2%) Frame = -2 Query: 560 TMDEENKKGAD--VEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEE 387 TMD + K+ D V++KVLFFARARDL G +EM L+V SGSTA DCL+K+ + +P LEE Sbjct: 12 TMDPKTKRIQDSSVKMKVLFFARARDLTG-FTEMPLEVSSGSTANDCLNKLISIFPSLEE 70 Query: 386 IRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 IR CMVLA+N EY E VV DKDELAIIPPISGG Sbjct: 71 IRGCMVLALNEEYTTESAVVQDKDELAIIPPISGG 105 >ref|XP_007019912.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 2 [Theobroma cacao] gi|508725240|gb|EOY17137.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 2 [Theobroma cacao] Length = 103 Score = 113 bits (283), Expect = 8e-23 Identities = 58/96 (60%), Positives = 74/96 (77%) Frame = -2 Query: 569 GFPTMDEENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLE 390 G P +DE G+ V+IKVLFFA+ARD+ G ++++ L+V SGST QDCL+K+ K+P LE Sbjct: 13 GTPVVDE----GSSVQIKVLFFAKARDITG-LTDLPLEVSSGSTTQDCLNKLVAKFPNLE 67 Query: 389 EIRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 +IR C+VLA+N EY E VV DKDELAIIPPISGG Sbjct: 68 DIRGCIVLALNEEYTTESAVVKDKDELAIIPPISGG 103 >ref|XP_002525500.1| conserved hypothetical protein [Ricinus communis] gi|223535179|gb|EEF36858.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 111 bits (278), Expect = 3e-22 Identities = 55/85 (64%), Positives = 68/85 (80%) Frame = -2 Query: 536 GADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRECMVLAVN 357 G+ ++IKVLFFARARDL G +SEM L+V SGST DCL+K+ ++P LEEIR C+VLA+N Sbjct: 20 GSSIKIKVLFFARARDLTG-LSEMPLEVSSGSTTNDCLNKLVAQFPSLEEIRRCIVLALN 78 Query: 356 LEYVPEFTVVNDKDELAIIPPISGG 282 EY E +V +KDELAIIPPISGG Sbjct: 79 EEYTTESAIVREKDELAIIPPISGG 103 >ref|XP_003598217.2| molybdopterin synthase sulfur carrier subunit [Medicago truncatula] gi|388495418|gb|AFK35775.1| unknown [Medicago truncatula] gi|657391696|gb|AES68468.2| molybdopterin synthase sulfur carrier subunit [Medicago truncatula] Length = 103 Score = 111 bits (278), Expect = 3e-22 Identities = 56/90 (62%), Positives = 71/90 (78%) Frame = -2 Query: 551 EENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRECM 372 + ++ + V+IKVLFFARARDL G +SE+ L+V SGST QDCL K+ ++P LEEI+ CM Sbjct: 15 QTKRESSLVKIKVLFFARARDLTG-LSEVPLEVSSGSTTQDCLKKLLVQFPSLEEIKGCM 73 Query: 371 VLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 VLA+N EY + T+V DKDELAIIPPISGG Sbjct: 74 VLALNEEYTMDSTIVKDKDELAIIPPISGG 103 >gb|KHG23145.1| hypothetical protein F383_09778 [Gossypium arboreum] Length = 129 Score = 111 bits (277), Expect = 4e-22 Identities = 55/94 (58%), Positives = 72/94 (76%) Frame = -2 Query: 563 PTMDEENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEI 384 P + K + V+IKVLFFA+ARD+ G ++E+ ++V SGST QDCL+K+ K+P L+EI Sbjct: 37 PAVQSVVKDESFVQIKVLFFAKARDITG-LTELSMEVSSGSTTQDCLNKLVAKFPNLDEI 95 Query: 383 RECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 R+C+VLA+N EY E VV DKDELAIIPPISGG Sbjct: 96 RQCIVLALNEEYTTESAVVKDKDELAIIPPISGG 129 >ref|XP_008237751.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Prunus mume] Length = 105 Score = 111 bits (277), Expect = 4e-22 Identities = 58/95 (61%), Positives = 72/95 (75%), Gaps = 2/95 (2%) Frame = -2 Query: 560 TMDEENK--KGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEE 387 TMD K +G+ V+IKV+FFARARDL G +SEM L+V +GS+A DCL+K+ +P L E Sbjct: 12 TMDSTTKGIEGSSVKIKVMFFARARDLTG-LSEMPLEVSTGSSADDCLNKLIAMFPGLTE 70 Query: 386 IRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 +R CMVLA+N EY E +V DKDELAIIPPISGG Sbjct: 71 LRGCMVLALNEEYTTESAIVKDKDELAIIPPISGG 105 >gb|AFK46858.1| unknown [Lotus japonicus] Length = 103 Score = 111 bits (277), Expect = 4e-22 Identities = 60/97 (61%), Positives = 73/97 (75%), Gaps = 4/97 (4%) Frame = -2 Query: 560 TMDEEN----KKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQL 393 T D +N K+ A V+IKVLFFARARDL G +SE+ L+V SGST +DCL K+ ++P L Sbjct: 8 TCDGDNMHSKKESALVKIKVLFFARARDLTG-LSEVPLEVTSGSTTRDCLKKLLAQFPSL 66 Query: 392 EEIRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 EEI+ CMVLA+N EY E T+V D DELAIIPPISGG Sbjct: 67 EEIQGCMVLALNEEYTTESTIVKDTDELAIIPPISGG 103 >ref|XP_004499653.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Cicer arietinum] Length = 103 Score = 110 bits (276), Expect = 5e-22 Identities = 57/90 (63%), Positives = 71/90 (78%), Gaps = 1/90 (1%) Frame = -2 Query: 548 ENKKGADV-EIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRECM 372 + +KG + +IKVLFFARARDL G +SE+ L+V SGSTA DCL K+ ++P LEEI+ CM Sbjct: 15 QTEKGISLMKIKVLFFARARDLTG-LSEVQLEVSSGSTAHDCLKKLLVQFPSLEEIQGCM 73 Query: 371 VLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 VLA+N EY + T+V DKDELAIIPPISGG Sbjct: 74 VLALNEEYTTDSTIVKDKDELAIIPPISGG 103 >gb|KNA15202.1| hypothetical protein SOVF_100510 [Spinacia oleracea] Length = 103 Score = 110 bits (275), Expect = 7e-22 Identities = 57/90 (63%), Positives = 72/90 (80%) Frame = -2 Query: 551 EENKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRECM 372 E N+K + +++KVLFFARARDL G +++M L+V SGSTA+DCL KI T++P LEEIR CM Sbjct: 16 ERNEKSS-IQLKVLFFARARDLTG-LADMPLEVTSGSTARDCLDKIVTQFPGLEEIRGCM 73 Query: 371 VLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 VLA+N EY E +V +DELAIIPPISGG Sbjct: 74 VLALNEEYASESAIVQHRDELAIIPPISGG 103 >ref|XP_007200636.1| hypothetical protein PRUPE_ppa013746mg [Prunus persica] gi|462396036|gb|EMJ01835.1| hypothetical protein PRUPE_ppa013746mg [Prunus persica] Length = 105 Score = 110 bits (275), Expect = 7e-22 Identities = 57/95 (60%), Positives = 73/95 (76%), Gaps = 2/95 (2%) Frame = -2 Query: 560 TMDEENK--KGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEE 387 T+D +K +G+ V+IKV+FFARARDL G +SEM L+V +GS+A DCL+K+ +P L E Sbjct: 12 TLDSTSKGIEGSSVKIKVMFFARARDLTG-LSEMPLEVSTGSSADDCLNKLIAMFPGLTE 70 Query: 386 IRECMVLAVNLEYVPEFTVVNDKDELAIIPPISGG 282 +R CMVLA+N EY E +V DKDELAIIPPISGG Sbjct: 71 LRGCMVLALNEEYTTESAIVKDKDELAIIPPISGG 105 >ref|XP_006478433.1| PREDICTED: molybdopterin synthase sulfur carrier subunit-like isoform X1 [Citrus sinensis] gi|568849374|ref|XP_006478434.1| PREDICTED: molybdopterin synthase sulfur carrier subunit-like isoform X2 [Citrus sinensis] gi|641827675|gb|KDO46852.1| hypothetical protein CISIN_1g034057mg [Citrus sinensis] gi|641827676|gb|KDO46853.1| hypothetical protein CISIN_1g034057mg [Citrus sinensis] gi|641827677|gb|KDO46854.1| hypothetical protein CISIN_1g034057mg [Citrus sinensis] Length = 105 Score = 110 bits (274), Expect = 9e-22 Identities = 54/88 (61%), Positives = 69/88 (78%) Frame = -2 Query: 545 NKKGADVEIKVLFFARARDLAGDVSEMMLQVPSGSTAQDCLSKIFTKYPQLEEIRECMVL 366 + K + ++IKVLFFARARDL G +++M L+V GST QDCL+K+ ++P LEEIR CMVL Sbjct: 19 DNKESSIQIKVLFFARARDLTG-LTDMPLEVSCGSTTQDCLNKLIARFPNLEEIRGCMVL 77 Query: 365 AVNLEYVPEFTVVNDKDELAIIPPISGG 282 A+N EY +VN+KDELAIIPPISGG Sbjct: 78 ALNEEYTNASVIVNEKDELAIIPPISGG 105