BLASTX nr result
ID: Papaver31_contig00001337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00001337 (813 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO37009.1| hypothetical protein CISIN_1g028047mg [Citrus sin... 59 4e-06 ref|XP_006426657.1| hypothetical protein CICLE_v10025803mg [Citr... 59 4e-06 gb|KDO65029.1| hypothetical protein CISIN_1g0163121mg, partial [... 58 9e-06 ref|XP_006465920.1| PREDICTED: mitochondrial ubiquitin ligase ac... 58 9e-06 >gb|KDO37009.1| hypothetical protein CISIN_1g028047mg [Citrus sinensis] Length = 214 Score = 58.9 bits (141), Expect = 4e-06 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -2 Query: 524 VLGEEKVMSIGKKISAVGVCSF--GVPQIKSSQDLPYFL*EK 405 VL EEK++ +GK ISAVG+CSF G+P+IKS +DLPYFL EK Sbjct: 40 VLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEK 81 >ref|XP_006426657.1| hypothetical protein CICLE_v10025803mg [Citrus clementina] gi|557528647|gb|ESR39897.1| hypothetical protein CICLE_v10025803mg [Citrus clementina] Length = 391 Score = 58.9 bits (141), Expect = 4e-06 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -2 Query: 524 VLGEEKVMSIGKKISAVGVCSF--GVPQIKSSQDLPYFL*EK 405 VL EEK++ +GK ISAVG+CSF G+P+IKS +DLPYFL EK Sbjct: 217 VLAEEKILPLGKDISAVGICSFKNGIPEIKSCKDLPYFLSEK 258 >gb|KDO65029.1| hypothetical protein CISIN_1g0163121mg, partial [Citrus sinensis] Length = 268 Score = 57.8 bits (138), Expect = 9e-06 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -2 Query: 524 VLGEEKVMSIGKKISAVGVCSF--GVPQIKSSQDLPYFL*EK 405 VL EEK++ +GK ISAVG+C+F G+P+IKS +DLPYFL EK Sbjct: 94 VLAEEKILPLGKDISAVGICNFKNGIPEIKSCKDLPYFLSEK 135 >ref|XP_006465920.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Citrus sinensis] Length = 391 Score = 57.8 bits (138), Expect = 9e-06 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -2 Query: 524 VLGEEKVMSIGKKISAVGVCSF--GVPQIKSSQDLPYFL*EK 405 VL EEK++ +GK ISAVG+C+F G+P+IKS +DLPYFL EK Sbjct: 217 VLAEEKILPLGKDISAVGICNFKNGIPEIKSCKDLPYFLSEK 258