BLASTX nr result
ID: Papaver31_contig00000573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00000573 (1026 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyru... 104 1e-19 ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malu... 104 1e-19 ref|XP_011654821.1| PREDICTED: 60S ribosomal protein L15-2 [Cucu... 103 2e-19 ref|XP_012439468.1| PREDICTED: 60S ribosomal protein L15-1 isofo... 103 2e-19 ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [P... 103 2e-19 ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [P... 103 2e-19 ref|XP_012466674.1| PREDICTED: 60S ribosomal protein L15-1-like ... 103 2e-19 gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arbo... 103 2e-19 ref|XP_012489073.1| PREDICTED: 60S ribosomal protein L15 [Gossyp... 103 2e-19 ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like ... 103 2e-19 ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isofo... 103 2e-19 ref|XP_012070019.1| PREDICTED: 60S ribosomal protein L15-1 isofo... 103 2e-19 ref|XP_012090464.1| PREDICTED: 60S ribosomal protein L15 [Jatrop... 103 2e-19 gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sin... 103 2e-19 ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Euca... 103 2e-19 ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Euca... 103 2e-19 gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] 103 2e-19 ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Viti... 103 2e-19 ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocar... 103 2e-19 ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [C... 103 2e-19 >ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri] gi|694412480|ref|XP_009334556.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri] Length = 235 Score = 104 bits (259), Expect = 1e-19 Identities = 50/58 (86%), Positives = 52/58 (89%), Gaps = 3/58 (5%) Frame = -3 Query: 697 AMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 AMGAYKYVSE+WRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 31 AMGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 88 >ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica] gi|658056084|ref|XP_008363794.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica] Length = 236 Score = 104 bits (259), Expect = 1e-19 Identities = 50/58 (86%), Positives = 52/58 (89%), Gaps = 3/58 (5%) Frame = -3 Query: 697 AMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 AMGAYKYVSE+WRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 32 AMGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 89 >ref|XP_011654821.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis sativus] Length = 226 Score = 103 bits (258), Expect = 2e-19 Identities = 50/60 (83%), Positives = 52/60 (86%), Gaps = 3/60 (5%) Frame = -3 Query: 703 ILAMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 + MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 20 LFPMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQ 79 >ref|XP_012439468.1| PREDICTED: 60S ribosomal protein L15-1 isoform X1 [Gossypium raimondii] gi|823213450|ref|XP_012439469.1| PREDICTED: 60S ribosomal protein L15-1 isoform X2 [Gossypium raimondii] gi|763784771|gb|KJB51842.1| hypothetical protein B456_008G234000 [Gossypium raimondii] gi|763784772|gb|KJB51843.1| hypothetical protein B456_008G234000 [Gossypium raimondii] gi|763784773|gb|KJB51844.1| hypothetical protein B456_008G234000 [Gossypium raimondii] gi|763784775|gb|KJB51846.1| hypothetical protein B456_008G234000 [Gossypium raimondii] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIIRVNHPTRPDKARRLGYKAKQ 57 >ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVKHPTRPDKARRLGYKAKQ 57 >ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica] Length = 228 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 25 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQ 81 >ref|XP_012466674.1| PREDICTED: 60S ribosomal protein L15-1-like [Gossypium raimondii] gi|728843354|gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum] gi|763740372|gb|KJB07871.1| hypothetical protein B456_001G049600 [Gossypium raimondii] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQ 57 >gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQ 57 >ref|XP_012489073.1| PREDICTED: 60S ribosomal protein L15 [Gossypium raimondii] gi|728812558|gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum] gi|763772970|gb|KJB40093.1| hypothetical protein B456_007G046500 [Gossypium raimondii] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQ 57 >ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo] gi|659102595|ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo] gi|659102597|ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQ 57 >ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo] gi|659107884|ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQ 57 >ref|XP_012070019.1| PREDICTED: 60S ribosomal protein L15-1 isoform X2 [Jatropha curcas] gi|643732902|gb|KDP39891.1| hypothetical protein JCGZ_03422 [Jatropha curcas] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQ 57 >ref|XP_012090464.1| PREDICTED: 60S ribosomal protein L15 [Jatropha curcas] gi|643706310|gb|KDP22442.1| hypothetical protein JCGZ_26273 [Jatropha curcas] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQ 57 >gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis] Length = 195 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 57 >ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Eucalyptus grandis] gi|629126426|gb|KCW90851.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQ 57 >ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Eucalyptus grandis] gi|629112847|gb|KCW77807.1| hypothetical protein EUGRSUZ_D02096 [Eucalyptus grandis] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQ 57 >gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQ 57 >ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 57 >ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocarpa] gi|566202763|ref|XP_006375250.1| 60S ribosomal protein L15 [Populus trichocarpa] gi|743788284|ref|XP_011033124.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica] gi|222842976|gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa] gi|550323569|gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQ 57 >ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis] gi|641830862|gb|KDO49938.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis] Length = 204 Score = 103 bits (257), Expect = 2e-19 Identities = 50/57 (87%), Positives = 51/57 (89%), Gaps = 3/57 (5%) Frame = -3 Query: 694 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSICRV---TRPDKDRHLGYKAKK 533 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSI RV TRPDK R LGYKAK+ Sbjct: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 57