BLASTX nr result
ID: Papaver30_contig00061680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00061680 (435 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010031461.1| PREDICTED: uncharacterized protein LOC104421... 58 3e-06 gb|KCW50769.1| hypothetical protein EUGRSUZ_J00433 [Eucalyptus g... 58 3e-06 gb|KCW50768.1| hypothetical protein EUGRSUZ_J00433 [Eucalyptus g... 57 7e-06 >ref|XP_010031461.1| PREDICTED: uncharacterized protein LOC104421265 [Eucalyptus grandis] Length = 276 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 433 NGNCGVGLKCVCYPKQCRDRVLTGGASSVNYVCYSAFFTSILF 305 NGNCGVGLKC+C+P++CRDRV++GG +S S F S+LF Sbjct: 229 NGNCGVGLKCICHPRECRDRVISGGGAS------SKPFGSVLF 265 >gb|KCW50769.1| hypothetical protein EUGRSUZ_J00433 [Eucalyptus grandis] Length = 147 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 433 NGNCGVGLKCVCYPKQCRDRVLTGGASSVNYVCYSAFFTSILF 305 NGNCGVGLKC+C+P++CRDRV++GG +S S F S+LF Sbjct: 100 NGNCGVGLKCICHPRECRDRVISGGGAS------SKPFGSVLF 136 >gb|KCW50768.1| hypothetical protein EUGRSUZ_J00433 [Eucalyptus grandis] Length = 206 Score = 56.6 bits (135), Expect = 7e-06 Identities = 20/28 (71%), Positives = 27/28 (96%) Frame = -3 Query: 433 NGNCGVGLKCVCYPKQCRDRVLTGGASS 350 NGNCGVGLKC+C+P++CRDRV++GG +S Sbjct: 100 NGNCGVGLKCICHPRECRDRVISGGGAS 127