BLASTX nr result
ID: Papaver30_contig00061506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00061506 (522 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009777242.1| PREDICTED: oligopeptide transporter 1-like [... 97 8e-20 ref|XP_010096486.1| Oligopeptide transporter 1 [Morus notabilis]... 96 2e-19 ref|XP_010096485.1| Oligopeptide transporter 1 [Morus notabilis]... 96 2e-19 ref|XP_006474839.1| PREDICTED: oligopeptide transporter 1-like [... 93 1e-18 ref|XP_006452635.1| hypothetical protein CICLE_v10007550mg [Citr... 93 1e-18 ref|XP_011069784.1| PREDICTED: oligopeptide transporter 5-like [... 92 1e-18 gb|KDO59179.1| hypothetical protein CISIN_1g004845mg [Citrus sin... 93 1e-18 ref|XP_006452637.1| hypothetical protein CICLE_v10007550mg [Citr... 93 1e-18 ref|XP_006474840.1| PREDICTED: oligopeptide transporter 1-like [... 93 2e-18 ref|XP_006452634.1| hypothetical protein CICLE_v10007552mg [Citr... 93 2e-18 gb|KDO59178.1| hypothetical protein CISIN_1g0044241mg, partial [... 93 2e-18 gb|EPS60835.1| hypothetical protein M569_13965 [Genlisea aurea] 92 2e-18 ref|XP_011040149.1| PREDICTED: oligopeptide transporter 1-like i... 92 3e-18 ref|XP_010052485.1| PREDICTED: oligopeptide transporter 1-like [... 92 3e-18 ref|XP_011040150.1| PREDICTED: oligopeptide transporter 1-like i... 92 3e-18 ref|XP_002323113.2| hypothetical protein POPTR_0016s00650g [Popu... 92 3e-18 gb|KCW76554.1| hypothetical protein EUGRSUZ_D00943 [Eucalyptus g... 92 3e-18 ref|XP_009600998.1| PREDICTED: oligopeptide transporter 1-like [... 92 4e-18 ref|XP_006452632.1| hypothetical protein CICLE_v10010604mg, part... 91 5e-18 emb|CBI29553.3| unnamed protein product [Vitis vinifera] 94 7e-18 >ref|XP_009777242.1| PREDICTED: oligopeptide transporter 1-like [Nicotiana sylvestris] Length = 737 Score = 97.4 bits (241), Expect(2) = 8e-20 Identities = 43/60 (71%), Positives = 52/60 (86%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LH+VE+RPKGGLTRLQFF+ VLV+ F YY++ Y FPSIT+LS VCWIWKDSVTA +L Sbjct: 192 RALHDVEKRPKGGLTRLQFFIVVLVSSFSYYIVPNYLFPSITALSFVCWIWKDSVTAQQL 251 Score = 26.2 bits (56), Expect(2) = 8e-20 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 177 PYMWWPSNL 185 >ref|XP_010096486.1| Oligopeptide transporter 1 [Morus notabilis] gi|587875497|gb|EXB64606.1| Oligopeptide transporter 1 [Morus notabilis] Length = 749 Score = 96.3 bits (238), Expect(2) = 2e-19 Identities = 42/60 (70%), Positives = 51/60 (85%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHEVE+RPKGGLTRLQFFL VL + F YY++ Y FPSIT+LS VCW+WKDSVTA ++ Sbjct: 204 RALHEVEKRPKGGLTRLQFFLMVLASSFAYYIVPNYLFPSITALSFVCWVWKDSVTAQQI 263 Score = 26.2 bits (56), Expect(2) = 2e-19 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 189 PYMWWPSNL 197 >ref|XP_010096485.1| Oligopeptide transporter 1 [Morus notabilis] gi|587875496|gb|EXB64605.1| Oligopeptide transporter 1 [Morus notabilis] Length = 749 Score = 96.3 bits (238), Expect(2) = 2e-19 Identities = 42/60 (70%), Positives = 51/60 (85%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHEVE+RPKGGLTRLQFFL VL + F YY++ Y FPSIT+LS VCW+WKDSVTA ++ Sbjct: 204 RALHEVEKRPKGGLTRLQFFLIVLASSFAYYIVPNYLFPSITALSFVCWVWKDSVTAQQI 263 Score = 26.2 bits (56), Expect(2) = 2e-19 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 189 PYMWWPSNL 197 >ref|XP_006474839.1| PREDICTED: oligopeptide transporter 1-like [Citrus sinensis] Length = 773 Score = 93.2 bits (230), Expect(2) = 1e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE E+R KGGLTRLQFF+ V ++ F YYV+ GY FPSI++LS VCWIWKDSVTA KL Sbjct: 226 RALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDSVTAQKL 285 Score = 26.6 bits (57), Expect(2) = 1e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 211 PYMWWPANL 219 >ref|XP_006452635.1| hypothetical protein CICLE_v10007550mg [Citrus clementina] gi|557555861|gb|ESR65875.1| hypothetical protein CICLE_v10007550mg [Citrus clementina] Length = 755 Score = 93.2 bits (230), Expect(2) = 1e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE E+R KGGLTRLQFF+ V ++ F YYV+ GY FPSI++LS VCWIWKDSVTA KL Sbjct: 208 RALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDSVTAQKL 267 Score = 26.6 bits (57), Expect(2) = 1e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 193 PYMWWPANL 201 >ref|XP_011069784.1| PREDICTED: oligopeptide transporter 5-like [Sesamum indicum] Length = 755 Score = 92.0 bits (227), Expect(2) = 1e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHEVE R KGGLTRLQFF+ VLV+ F YY++ Y FPSIT+LS VCWIWKDSVTA ++ Sbjct: 210 RALHEVEVRRKGGLTRLQFFIIVLVSSFSYYIVPNYLFPSITALSFVCWIWKDSVTAQQI 269 Score = 27.7 bits (60), Expect(2) = 1e-18 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP+NL Sbjct: 195 PYMWWPINL 203 >gb|KDO59179.1| hypothetical protein CISIN_1g004845mg [Citrus sinensis] Length = 728 Score = 93.2 bits (230), Expect(2) = 1e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE E+R KGGLTRLQFF+ V ++ F YYV+ GY FPSI++LS VCWIWKDSVTA KL Sbjct: 181 RALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDSVTAQKL 240 Score = 26.6 bits (57), Expect(2) = 1e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 166 PYMWWPANL 174 >ref|XP_006452637.1| hypothetical protein CICLE_v10007550mg [Citrus clementina] gi|557555863|gb|ESR65877.1| hypothetical protein CICLE_v10007550mg [Citrus clementina] Length = 728 Score = 93.2 bits (230), Expect(2) = 1e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE E+R KGGLTRLQFF+ V ++ F YYV+ GY FPSI++LS VCWIWKDSVTA KL Sbjct: 181 RALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDSVTAQKL 240 Score = 26.6 bits (57), Expect(2) = 1e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 166 PYMWWPANL 174 >ref|XP_006474840.1| PREDICTED: oligopeptide transporter 1-like [Citrus sinensis] Length = 754 Score = 92.8 bits (229), Expect(2) = 2e-18 Identities = 43/60 (71%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE ERRPKGGLTRLQFFL V V+ F YY+I GY FPS+++LS VC IWKDS+TA KL Sbjct: 207 RALHEKERRPKGGLTRLQFFLLVFVSSFGYYIIPGYLFPSLSALSFVCLIWKDSITAQKL 266 Score = 26.2 bits (56), Expect(2) = 2e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 192 PYMWWPSNL 200 >ref|XP_006452634.1| hypothetical protein CICLE_v10007552mg [Citrus clementina] gi|557555860|gb|ESR65874.1| hypothetical protein CICLE_v10007552mg [Citrus clementina] Length = 754 Score = 92.8 bits (229), Expect(2) = 2e-18 Identities = 43/60 (71%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE ERRPKGGLTRLQFFL V V+ F YY+I GY FPS+++LS VC IWKDS+TA KL Sbjct: 207 RALHEKERRPKGGLTRLQFFLLVFVSSFGYYIIPGYLFPSLSALSFVCLIWKDSITAQKL 266 Score = 26.2 bits (56), Expect(2) = 2e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 192 PYMWWPSNL 200 >gb|KDO59178.1| hypothetical protein CISIN_1g0044241mg, partial [Citrus sinensis] Length = 728 Score = 92.8 bits (229), Expect(2) = 2e-18 Identities = 43/60 (71%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE ERRPKGGLTRLQFFL V V+ F YY+I GY FPS+++LS VC IWKDS+TA KL Sbjct: 181 RALHEKERRPKGGLTRLQFFLLVFVSSFGYYIIPGYLFPSLSALSFVCLIWKDSITAQKL 240 Score = 26.2 bits (56), Expect(2) = 2e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 166 PYMWWPSNL 174 >gb|EPS60835.1| hypothetical protein M569_13965 [Genlisea aurea] Length = 743 Score = 92.4 bits (228), Expect(2) = 2e-18 Identities = 43/60 (71%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LH+VE R KGGLTRLQFF VLV+ F YYV+ GY FPSIT+LS VCWIWKDSVTA ++ Sbjct: 199 RALHDVEVRRKGGLTRLQFFAIVLVSSFSYYVVPGYLFPSITALSFVCWIWKDSVTAQQI 258 Score = 26.2 bits (56), Expect(2) = 2e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 184 PYMWWPSNL 192 >ref|XP_011040149.1| PREDICTED: oligopeptide transporter 1-like isoform X1 [Populus euphratica] Length = 766 Score = 92.0 bits (227), Expect(2) = 3e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHEVE R KGGLTRLQFFL VL++ F YY++ GY F SIT+LS VCWIWKDSVTA ++ Sbjct: 221 RALHEVEIRRKGGLTRLQFFLVVLISSFAYYIVPGYLFQSITALSFVCWIWKDSVTAQQI 280 Score = 26.2 bits (56), Expect(2) = 3e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 206 PYMWWPSNL 214 >ref|XP_010052485.1| PREDICTED: oligopeptide transporter 1-like [Eucalyptus grandis] Length = 754 Score = 91.7 bits (226), Expect(2) = 3e-18 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE E RPKGGL RLQFFL VL++ F YYV+ Y FPSIT+LS VCWIWKDSVTA ++ Sbjct: 209 RALHEEEVRPKGGLMRLQFFLIVLISSFAYYVVPNYLFPSITALSFVCWIWKDSVTAQQI 268 Score = 26.6 bits (57), Expect(2) = 3e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 194 PYMWWPANL 202 >ref|XP_011040150.1| PREDICTED: oligopeptide transporter 1-like isoform X2 [Populus euphratica] Length = 748 Score = 92.0 bits (227), Expect(2) = 3e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHEVE R KGGLTRLQFFL VL++ F YY++ GY F SIT+LS VCWIWKDSVTA ++ Sbjct: 203 RALHEVEIRRKGGLTRLQFFLVVLISSFAYYIVPGYLFQSITALSFVCWIWKDSVTAQQI 262 Score = 26.2 bits (56), Expect(2) = 3e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 188 PYMWWPSNL 196 >ref|XP_002323113.2| hypothetical protein POPTR_0016s00650g [Populus trichocarpa] gi|550320498|gb|EEF04874.2| hypothetical protein POPTR_0016s00650g [Populus trichocarpa] Length = 748 Score = 92.0 bits (227), Expect(2) = 3e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHEVE R KGGLTRLQFFL VL++ F YY++ GY F SIT+LS VCWIWKDSVTA ++ Sbjct: 203 RALHEVEIRRKGGLTRLQFFLVVLISSFAYYIVPGYLFQSITALSFVCWIWKDSVTAQQI 262 Score = 26.2 bits (56), Expect(2) = 3e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 188 PYMWWPSNL 196 >gb|KCW76554.1| hypothetical protein EUGRSUZ_D00943 [Eucalyptus grandis] Length = 732 Score = 91.7 bits (226), Expect(2) = 3e-18 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE E RPKGGL RLQFFL VL++ F YYV+ Y FPSIT+LS VCWIWKDSVTA ++ Sbjct: 187 RALHEEEVRPKGGLMRLQFFLIVLISSFAYYVVPNYLFPSITALSFVCWIWKDSVTAQQI 246 Score = 26.6 bits (57), Expect(2) = 3e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 172 PYMWWPANL 180 >ref|XP_009600998.1| PREDICTED: oligopeptide transporter 1-like [Nicotiana tomentosiformis] Length = 737 Score = 91.7 bits (226), Expect(2) = 4e-18 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LH+VE+RPKGGLTRLQFF+ VLV+ F YY++ Y FPSIT+LS VC IWKDSVTA ++ Sbjct: 192 RALHDVEKRPKGGLTRLQFFIVVLVSSFSYYIVPNYLFPSITALSFVCLIWKDSVTAQQI 251 Score = 26.2 bits (56), Expect(2) = 4e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 177 PYMWWPSNL 185 >ref|XP_006452632.1| hypothetical protein CICLE_v10010604mg, partial [Citrus clementina] gi|557555858|gb|ESR65872.1| hypothetical protein CICLE_v10010604mg, partial [Citrus clementina] Length = 728 Score = 90.9 bits (224), Expect(2) = 5e-18 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHE E+RPKGGLTR+QFF V V+ F YY++ GY FPS+T+LS VCWIWK SVTA ++ Sbjct: 181 RALHEKEKRPKGGLTRIQFFFVVFVSSFAYYIVPGYLFPSLTALSFVCWIWKRSVTAQQI 240 Score = 26.6 bits (57), Expect(2) = 5e-18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWWP NL Sbjct: 166 PYMWWPANL 174 >emb|CBI29553.3| unnamed protein product [Vitis vinifera] Length = 6298 Score = 94.0 bits (232), Expect(2) = 7e-18 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = -3 Query: 253 RSLHEVERRPKGGLTRLQFFLAVLVAIF*YYVILGYFFPSITSLSLVCWIWKDSVTAHKL 74 R+LHEVE RPKGG+TRLQFFL VLV+ F YY++ Y FPSIT+LS +CWIWKDS+TA ++ Sbjct: 184 RALHEVEIRPKGGVTRLQFFLVVLVSSFAYYIVPNYLFPSITALSFMCWIWKDSITAQQI 243 Score = 23.1 bits (48), Expect(2) = 7e-18 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 359 PYMWWPLNL 333 PYMWW NL Sbjct: 169 PYMWWSSNL 177