BLASTX nr result
ID: Papaver30_contig00060907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00060907 (666 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208966.1| hypothetical protein PRUPE_ppb019935mg [Prun... 60 1e-06 >ref|XP_007208966.1| hypothetical protein PRUPE_ppb019935mg [Prunus persica] gi|462404701|gb|EMJ10165.1| hypothetical protein PRUPE_ppb019935mg [Prunus persica] Length = 651 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +3 Query: 375 NHDTTIPTKKNNNLEAPYEGMQFNSYEEAKEYYTEYGRRNGFTIRVRS 518 N +T+ P KK L+APY GM F++ EEA+ YY EYGR+ GF IR RS Sbjct: 26 NGETSTPKKKVTQLKAPYSGMVFDTMEEARNYYEEYGRQEGFWIRTRS 73