BLASTX nr result
ID: Papaver30_contig00060880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00060880 (631 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013746911.1| PREDICTED: B3 domain-containing protein At5g... 73 2e-10 ref|XP_009123694.1| PREDICTED: B3 domain-containing protein At5g... 73 2e-10 emb|CDY02412.1| BnaA02g23210D [Brassica napus] 73 2e-10 emb|CDY21256.1| BnaC02g28670D [Brassica napus] 73 2e-10 ref|XP_008788064.1| PREDICTED: B3 domain-containing protein Os06... 71 6e-10 ref|XP_013620049.1| PREDICTED: B3 domain-containing protein At5g... 70 7e-10 ref|XP_010922413.1| PREDICTED: B3 domain-containing protein Os06... 70 1e-09 ref|XP_010922411.1| PREDICTED: B3 domain-containing protein Os06... 70 1e-09 ref|XP_011458940.1| PREDICTED: B3 domain-containing protein At5g... 70 1e-09 emb|CDP01348.1| unnamed protein product [Coffea canephora] 70 1e-09 ref|XP_011458939.1| PREDICTED: B3 domain-containing protein At5g... 69 2e-09 ref|XP_010520114.1| PREDICTED: B3 domain-containing protein At5g... 69 2e-09 ref|XP_010539066.1| PREDICTED: B3 domain-containing protein At5g... 69 2e-09 ref|XP_006346419.1| PREDICTED: B3 domain-containing protein At3g... 68 4e-09 gb|EAY88816.1| hypothetical protein OsI_10288 [Oryza sativa Indi... 68 4e-09 ref|NP_001049190.1| Os03g0184500 [Oryza sativa Japonica Group] g... 68 4e-09 ref|XP_010061764.1| PREDICTED: B3 domain-containing protein At3g... 68 5e-09 ref|XP_008444633.1| PREDICTED: B3 domain-containing protein At5g... 68 5e-09 ref|XP_010061766.1| PREDICTED: B3 domain-containing protein At3g... 68 5e-09 ref|NP_001131637.1| hypothetical protein [Zea mays] gi|194692110... 68 5e-09 >ref|XP_013746911.1| PREDICTED: B3 domain-containing protein At5g42700 [Brassica napus] Length = 227 Score = 72.8 bits (177), Expect = 2e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPTL 173 L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +PT+ Sbjct: 154 LQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRPTV 210 >ref|XP_009123694.1| PREDICTED: B3 domain-containing protein At5g42700 [Brassica rapa] gi|923701117|ref|XP_013659682.1| PREDICTED: B3 domain-containing protein At5g42700-like [Brassica napus] Length = 266 Score = 72.8 bits (177), Expect = 2e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPTL 173 L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +PT+ Sbjct: 193 LQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRPTV 249 >emb|CDY02412.1| BnaA02g23210D [Brassica napus] Length = 232 Score = 72.8 bits (177), Expect = 2e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPTL 173 L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +PT+ Sbjct: 159 LQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRPTV 215 >emb|CDY21256.1| BnaC02g28670D [Brassica napus] Length = 225 Score = 72.8 bits (177), Expect = 2e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPTL 173 L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +PT+ Sbjct: 152 LQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRPTV 208 >ref|XP_008788064.1| PREDICTED: B3 domain-containing protein Os06g0194400 [Phoenix dactylifera] gi|672129120|ref|XP_008788065.1| PREDICTED: B3 domain-containing protein Os06g0194400 [Phoenix dactylifera] Length = 226 Score = 70.9 bits (172), Expect = 6e-10 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LP+KD +T++DE GD+F++ YLA K GLSG W F+ YH L++GDA VF+ KPT Sbjct: 156 LPRKDTMMTLVDENGDEFKSLYLAPKNGLSGGWRGFSIYHELVDGDALVFQLVKPT 211 >ref|XP_013620049.1| PREDICTED: B3 domain-containing protein At5g42700 [Brassica oleracea var. oleracea] Length = 227 Score = 70.5 bits (171), Expect = 7e-10 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPTL 173 L K+D +T++DEEG++FE YLAK+ GLSG W+ FA H L+ GDA VFE +PT+ Sbjct: 154 LQKQDGVITLIDEEGEEFEIVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRPTV 210 >ref|XP_010922413.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform X2 [Elaeis guineensis] Length = 225 Score = 70.1 bits (170), Expect = 1e-09 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LP+KD +T++DE GD+F++ YLA K GLSG W F+ YH L++GDA +F+ KPT Sbjct: 155 LPRKDTMMTLVDENGDEFKSLYLAPKNGLSGGWRGFSIYHELVDGDALIFQLIKPT 210 >ref|XP_010922411.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Elaeis guineensis] gi|743787416|ref|XP_010922412.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Elaeis guineensis] Length = 226 Score = 70.1 bits (170), Expect = 1e-09 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LP+KD +T++DE GD+F++ YLA K GLSG W F+ YH L++GDA +F+ KPT Sbjct: 156 LPRKDTMMTLVDENGDEFKSLYLAPKNGLSGGWRGFSIYHELVDGDALIFQLIKPT 211 >ref|XP_011458940.1| PREDICTED: B3 domain-containing protein At5g42700-like [Fragaria vesca subsp. vesca] gi|764538763|ref|XP_011458941.1| PREDICTED: B3 domain-containing protein At5g42700-like [Fragaria vesca subsp. vesca] Length = 216 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK+DA VT++DE+G+++ T YL K GLSG W FA H L++GDA VF+ T+PT Sbjct: 149 LPKRDATVTLVDEQGEQYPTVYLENKKGLSGGWRGFAIAHELVDGDALVFQLTRPT 204 >emb|CDP01348.1| unnamed protein product [Coffea canephora] Length = 235 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/57 (54%), Positives = 43/57 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPTL 173 LPK+D VT++DE+GDK+ T YLA+K GLSG W F+ H L++GDA VF+ +PT+ Sbjct: 156 LPKRDDTVTLVDEQGDKWRTIYLARKTGLSGGWKKFSVDHDLVDGDALVFQLIQPTV 212 >ref|XP_011458939.1| PREDICTED: B3 domain-containing protein At5g42700-like [Fragaria vesca subsp. vesca] Length = 228 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 L KKD +T++DEEG+++ET YLA+K GLSG W FA H L++GDA VF+ KPT Sbjct: 160 LSKKDEIMTLVDEEGNEYETIYLARKTGLSGGWKGFAVAHDLVDGDAVVFQLIKPT 215 >ref|XP_010520114.1| PREDICTED: B3 domain-containing protein At5g42700-like [Tarenaya hassleriana] Length = 222 Score = 68.9 bits (167), Expect = 2e-09 Identities = 30/56 (53%), Positives = 43/56 (76%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK+D+ +T++DEEG+ +ET YLA+K GLSG W+ FA H L +GDA VF+ +P+ Sbjct: 153 LPKQDSAMTLIDEEGEVYETIYLARKTGLSGGWLGFAVAHDLADGDALVFQLVRPS 208 >ref|XP_010539066.1| PREDICTED: B3 domain-containing protein At5g42700 [Tarenaya hassleriana] Length = 223 Score = 68.9 bits (167), Expect = 2e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK D +T++DEEG+ +ET YLA+K GLSG W FA H L++GDA VF+ PT Sbjct: 153 LPKHDCAMTLIDEEGEDYETVYLARKTGLSGGWRGFAIAHNLVDGDALVFQLIHPT 208 >ref|XP_006346419.1| PREDICTED: B3 domain-containing protein At3g19184-like [Solanum tuberosum] Length = 224 Score = 68.2 bits (165), Expect = 4e-09 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK D VT++DE GD+F+T YLA K GLSG W FA H L++GDA VF+ PT Sbjct: 155 LPKHDEYVTLVDENGDEFQTKYLALKTGLSGGWRGFALDHELVDGDALVFQLVAPT 210 >gb|EAY88816.1| hypothetical protein OsI_10288 [Oryza sativa Indica Group] Length = 237 Score = 68.2 bits (165), Expect = 4e-09 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK DA VT+LDE+ ++F+T YLA K GLSG W FA H L++GDA VF+ KPT Sbjct: 163 LPKHDAIVTLLDEKDEQFDTNYLAYKNGLSGGWAGFALDHGLLDGDATVFQLVKPT 218 >ref|NP_001049190.1| Os03g0184500 [Oryza sativa Japonica Group] gi|122247450|sp|Q10QS9.1|Y3845_ORYSJ RecName: Full=B3 domain-containing protein Os03g0184500 gi|15217278|gb|AAK92622.1|AC079633_2 Unknown protein [Oryza sativa Japonica Group] gi|108706553|gb|ABF94348.1| B3 DNA binding domain containing protein, expressed [Oryza sativa Japonica Group] gi|113547661|dbj|BAF11104.1| Os03g0184500 [Oryza sativa Japonica Group] gi|125585183|gb|EAZ25847.1| hypothetical protein OsJ_09687 [Oryza sativa Japonica Group] gi|215768526|dbj|BAH00755.1| unnamed protein product [Oryza sativa Japonica Group] gi|937907742|dbj|BAS82662.1| Os03g0184500 [Oryza sativa Japonica Group] Length = 237 Score = 68.2 bits (165), Expect = 4e-09 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK DA VT+LDE+ ++F+T YLA K GLSG W FA H L++GDA VF+ KPT Sbjct: 163 LPKHDAIVTLLDEKDEQFDTNYLAYKNGLSGGWAGFALDHGLLDGDATVFQLVKPT 218 >ref|XP_010061764.1| PREDICTED: B3 domain-containing protein At3g19184 isoform X1 [Eucalyptus grandis] Length = 234 Score = 67.8 bits (164), Expect = 5e-09 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK D +T++DE+G++F T YLA+K GLSG W F+ H L +GDA VF+ KPT Sbjct: 161 LPKNDGVITLVDEDGEEFPTIYLARKTGLSGGWKGFSVAHELTDGDAVVFQLIKPT 216 >ref|XP_008444633.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis melo] Length = 230 Score = 67.8 bits (164), Expect = 5e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LP +D +T++DE+GD++ T YLA+K GLSG W FA H+L +GDA +F+ KPT Sbjct: 153 LPNRDGVMTLIDEDGDEYPTIYLARKTGLSGGWKGFAVAHKLADGDAVIFQFIKPT 208 >ref|XP_010061766.1| PREDICTED: B3 domain-containing protein At3g19184 isoform X2 [Eucalyptus grandis] gi|629103291|gb|KCW68760.1| hypothetical protein EUGRSUZ_F02358 [Eucalyptus grandis] Length = 229 Score = 67.8 bits (164), Expect = 5e-09 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 LPK D +T++DE+G++F T YLA+K GLSG W F+ H L +GDA VF+ KPT Sbjct: 156 LPKNDGVITLVDEDGEEFPTIYLARKTGLSGGWKGFSVAHELTDGDAVVFQLIKPT 211 >ref|NP_001131637.1| hypothetical protein [Zea mays] gi|194692110|gb|ACF80139.1| unknown [Zea mays] gi|414865186|tpg|DAA43743.1| TPA: hypothetical protein ZEAMMB73_433086 [Zea mays] Length = 146 Score = 67.8 bits (164), Expect = 5e-09 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +3 Query: 3 LPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKPT 170 +PK+DA +T++DE+ ++F+T YLA K GLSG W FA YH + +GD+ VF+ KPT Sbjct: 72 MPKQDATITLVDEKDEEFDTNYLAYKKGLSGGWAGFALYHAIQDGDSTVFQLIKPT 127