BLASTX nr result
ID: Papaver30_contig00058924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00058924 (544 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854959.1| PREDICTED: putative F-box protein At2g02030 ... 57 7e-06 >ref|XP_012854959.1| PREDICTED: putative F-box protein At2g02030 [Erythranthe guttatus] Length = 389 Score = 56.6 bits (135), Expect = 7e-06 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = -1 Query: 442 MEYFKRLPEEITLDILARLPTEAVLECKLVCKTWRNLVGYPSFS 311 +++F+ LP EIT+D L+RLP ++ C+LVCK+WRNL+ F+ Sbjct: 3 LDFFRNLPPEITIDTLSRLPIRTIIRCRLVCKSWRNLIQTREFA 46