BLASTX nr result
ID: Papaver30_contig00056455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00056455 (572 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009775221.1| PREDICTED: alpha/beta hydrolase domain-conta... 58 4e-06 >ref|XP_009775221.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana sylvestris] gi|698572732|ref|XP_009775222.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana sylvestris] Length = 377 Score = 57.8 bits (138), Expect = 4e-06 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = -1 Query: 173 MGGVTSSMXXXXXXXXXXXPSYKVVVDESTGKLTITGIPKKDNVNADVLSIPTKRG 6 MGGVTSSM PSY VVV+ESTGKL +T +P K+NV DVL +PTKRG Sbjct: 1 MGGVTSSMAAKFAFFPPNPPSYGVVVEESTGKLKMTEVPAKENV--DVLRLPTKRG 54