BLASTX nr result
ID: Papaver30_contig00056181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00056181 (454 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA04698.1| hypothetical protein SOVF_197280, partial [Spinac... 45 2e-08 >gb|KNA04698.1| hypothetical protein SOVF_197280, partial [Spinacia oleracea] Length = 210 Score = 44.7 bits (104), Expect(2) = 2e-08 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -2 Query: 171 IASAFLTPLLKPGGGLRPIAVGTV 100 IASA LTPL+KPGGG+RPIAVGT+ Sbjct: 1 IASAPLTPLIKPGGGMRPIAVGTI 24 Score = 40.8 bits (94), Expect(2) = 2e-08 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -1 Query: 97 RRLVSKMAAFSVGKEMTSYLGDYQFGVGVPAG 2 RRLV K+ A +G + +YLG QFGVGVPAG Sbjct: 26 RRLVFKVGAALIGPRLGNYLGGLQFGVGVPAG 57