BLASTX nr result
ID: Papaver30_contig00056131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00056131 (733 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010246642.1| PREDICTED: BTB/POZ domain-containing protein... 72 3e-10 ref|XP_010246641.1| PREDICTED: BTB/POZ domain-containing protein... 72 3e-10 ref|XP_010246640.1| PREDICTED: BTB/POZ domain-containing protein... 72 3e-10 ref|XP_012087427.1| PREDICTED: BTB/POZ domain-containing protein... 65 5e-08 gb|KDP25127.1| hypothetical protein JCGZ_22662 [Jatropha curcas] 65 5e-08 ref|XP_011038105.1| PREDICTED: BTB/POZ domain-containing protein... 64 1e-07 ref|XP_011038102.1| PREDICTED: BTB/POZ domain-containing protein... 64 1e-07 ref|XP_002513424.1| conserved hypothetical protein [Ricinus comm... 63 2e-07 ref|XP_007022277.1| BTB/POZ domain-containing protein, putative ... 61 7e-07 ref|XP_007022276.1| BTB/POZ domain-containing protein, putative ... 61 7e-07 ref|XP_011460860.1| PREDICTED: BTB/POZ domain-containing protein... 60 2e-06 ref|XP_008226084.1| PREDICTED: BTB/POZ domain-containing protein... 59 3e-06 ref|XP_008226082.1| PREDICTED: BTB/POZ domain-containing protein... 59 3e-06 ref|XP_012848383.1| PREDICTED: BTB/POZ domain-containing protein... 59 4e-06 ref|XP_010475091.1| PREDICTED: BTB/POZ domain-containing protein... 57 1e-05 ref|XP_010475090.1| PREDICTED: BTB/POZ domain-containing protein... 57 1e-05 ref|XP_008444313.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma... 57 1e-05 >ref|XP_010246642.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X3 [Nelumbo nucifera] gi|720095316|ref|XP_010246643.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X3 [Nelumbo nucifera] Length = 930 Score = 72.4 bits (176), Expect = 3e-10 Identities = 32/52 (61%), Positives = 45/52 (86%) Frame = -1 Query: 730 LSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEGTSN 575 LS W++ + AA+Y+AP+YPQ+R+SG+LESL ELVDLVR ++VRL+QEG S+ Sbjct: 876 LSLWKMAEAAASYLAPLYPQLRNSGELESLDEELVDLVRSSHVRLSQEGVSD 927 >ref|XP_010246641.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Nelumbo nucifera] Length = 1029 Score = 72.4 bits (176), Expect = 3e-10 Identities = 32/52 (61%), Positives = 45/52 (86%) Frame = -1 Query: 730 LSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEGTSN 575 LS W++ + AA+Y+AP+YPQ+R+SG+LESL ELVDLVR ++VRL+QEG S+ Sbjct: 975 LSLWKMAEAAASYLAPLYPQLRNSGELESLDEELVDLVRSSHVRLSQEGVSD 1026 >ref|XP_010246640.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Nelumbo nucifera] Length = 1030 Score = 72.4 bits (176), Expect = 3e-10 Identities = 32/52 (61%), Positives = 45/52 (86%) Frame = -1 Query: 730 LSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEGTSN 575 LS W++ + AA+Y+AP+YPQ+R+SG+LESL ELVDLVR ++VRL+QEG S+ Sbjct: 976 LSLWKMAEAAASYLAPLYPQLRNSGELESLDEELVDLVRSSHVRLSQEGVSD 1027 >ref|XP_012087427.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 [Jatropha curcas] Length = 1009 Score = 65.1 bits (157), Expect = 5e-08 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = -1 Query: 733 ELSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 +LS W++V+VAA Y+AP+Y Q+ SGDLE+L E+VD++R A VRL+QEG Sbjct: 960 DLSLWKLVEVAAIYLAPLYRQLCHSGDLEALDEEVVDMIRAASVRLSQEG 1009 >gb|KDP25127.1| hypothetical protein JCGZ_22662 [Jatropha curcas] Length = 679 Score = 65.1 bits (157), Expect = 5e-08 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = -1 Query: 733 ELSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 +LS W++V+VAA Y+AP+Y Q+ SGDLE+L E+VD++R A VRL+QEG Sbjct: 630 DLSLWKLVEVAAIYLAPLYRQLCHSGDLEALDEEVVDMIRAASVRLSQEG 679 >ref|XP_011038105.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Populus euphratica] Length = 1016 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -1 Query: 733 ELSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 ELS W++ +VAA Y+AP Y Q+ +GDLE+L+ ELVD++R A VRL+QEG Sbjct: 967 ELSLWKLAEVAANYLAPFYRQLCHTGDLEALNEELVDMIRDASVRLSQEG 1016 >ref|XP_011038102.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Populus euphratica] gi|743887304|ref|XP_011038103.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Populus euphratica] gi|743887308|ref|XP_011038104.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Populus euphratica] Length = 1044 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -1 Query: 733 ELSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 ELS W++ +VAA Y+AP Y Q+ +GDLE+L+ ELVD++R A VRL+QEG Sbjct: 995 ELSLWKLAEVAANYLAPFYRQLCHTGDLEALNEELVDMIRDASVRLSQEG 1044 >ref|XP_002513424.1| conserved hypothetical protein [Ricinus communis] gi|223547332|gb|EEF48827.1| conserved hypothetical protein [Ricinus communis] Length = 1016 Score = 63.2 bits (152), Expect = 2e-07 Identities = 27/50 (54%), Positives = 39/50 (78%) Frame = -1 Query: 733 ELSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 + S W++V+VAA Y+AP Y Q+ +SGDLE L E++D++R A VRL+QEG Sbjct: 967 DFSLWKLVEVAANYLAPQYRQLCNSGDLEGLDEEVIDMIRAASVRLSQEG 1016 >ref|XP_007022277.1| BTB/POZ domain-containing protein, putative isoform 2 [Theobroma cacao] gi|508721905|gb|EOY13802.1| BTB/POZ domain-containing protein, putative isoform 2 [Theobroma cacao] Length = 692 Score = 61.2 bits (147), Expect = 7e-07 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -1 Query: 727 SQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQE 587 S W++V+VAA YMAP+Y ++RD+GDLE L LVDLVR A VRL+Q+ Sbjct: 640 SLWKLVEVAAEYMAPLYHKLRDTGDLEELDELLVDLVRDASVRLSQD 686 >ref|XP_007022276.1| BTB/POZ domain-containing protein, putative isoform 1 [Theobroma cacao] gi|508721904|gb|EOY13801.1| BTB/POZ domain-containing protein, putative isoform 1 [Theobroma cacao] Length = 1010 Score = 61.2 bits (147), Expect = 7e-07 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -1 Query: 727 SQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQE 587 S W++V+VAA YMAP+Y ++RD+GDLE L LVDLVR A VRL+Q+ Sbjct: 958 SLWKLVEVAAEYMAPLYHKLRDTGDLEELDELLVDLVRDASVRLSQD 1004 >ref|XP_011460860.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 [Fragaria vesca subsp. vesca] Length = 1015 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 730 LSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 LS W + +VA TYMAP+Y Q+ DSG+LE+L L D+VR+A VR +Q+G Sbjct: 962 LSLWNLAEVAVTYMAPVYRQLCDSGELETLDELLADMVRLASVRFSQQG 1010 >ref|XP_008226084.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Prunus mume] Length = 981 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = -1 Query: 730 LSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEGTSNN 572 LS W++ +VAATY AP+Y Q+ +SG+LESL LV++VR A V+L+Q+G +++ Sbjct: 928 LSVWKLAEVAATYAAPLYRQLCNSGELESLDEMLVEMVRAASVQLSQQGGNHS 980 >ref|XP_008226082.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Prunus mume] Length = 1012 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = -1 Query: 730 LSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEGTSNN 572 LS W++ +VAATY AP+Y Q+ +SG+LESL LV++VR A V+L+Q+G +++ Sbjct: 959 LSVWKLAEVAATYAAPLYRQLCNSGELESLDEMLVEMVRAASVQLSQQGGNHS 1011 >ref|XP_012848383.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 [Erythranthe guttatus] Length = 1022 Score = 58.5 bits (140), Expect = 4e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -1 Query: 727 SQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 SQW++ VAA +MAP Y Q+R SG+L+ L LV++VR A VRL+QEG Sbjct: 961 SQWKLAQVAANHMAPSYHQLRISGELDQLDDNLVEMVRAASVRLSQEG 1008 >ref|XP_010475091.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Camelina sativa] Length = 867 Score = 57.4 bits (137), Expect = 1e-05 Identities = 24/49 (48%), Positives = 38/49 (77%) Frame = -1 Query: 727 SQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEGT 581 S W++V+ AA + AP+Y Q+RDSG+L+ L ELV+L+R A V+ +Q+G+ Sbjct: 819 SMWKLVEAAANHAAPIYHQLRDSGELDELDDELVNLIRTAAVQFSQQGS 867 >ref|XP_010475090.1| PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Camelina sativa] Length = 1001 Score = 57.4 bits (137), Expect = 1e-05 Identities = 24/49 (48%), Positives = 38/49 (77%) Frame = -1 Query: 727 SQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEGT 581 S W++V+ AA + AP+Y Q+RDSG+L+ L ELV+L+R A V+ +Q+G+ Sbjct: 953 SMWKLVEAAANHAAPIYHQLRDSGELDELDDELVNLIRTAAVQFSQQGS 1001 >ref|XP_008444313.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At1g04390 [Cucumis melo] Length = 990 Score = 57.4 bits (137), Expect = 1e-05 Identities = 22/50 (44%), Positives = 38/50 (76%) Frame = -1 Query: 733 ELSQWEIVDVAATYMAPMYPQMRDSGDLESLSHELVDLVRVAYVRLTQEG 584 + S W++ ++AA ++AP+Y Q+R+ GDLE+L L+ ++R A +RL+QEG Sbjct: 940 DFSLWKLAEIAADFIAPLYSQLRNCGDLEALDERLLSMIRAASIRLSQEG 989