BLASTX nr result
ID: Papaver30_contig00053394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00053394 (521 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267457.1| PREDICTED: lysine-specific histone demethyla... 59 1e-06 >ref|XP_010267457.1| PREDICTED: lysine-specific histone demethylase 1 homolog 1 [Nelumbo nucifera] Length = 917 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 519 DGDGNRVRMLNQRFGVRLLGRKNLGNTGESLIACIKSVRMN 397 DGDGNRVR+LN+ +GVRL+GR LG+ GESLI+ IKS R++ Sbjct: 867 DGDGNRVRVLNRNYGVRLVGRSALGSVGESLISYIKSARIS 907