BLASTX nr result
ID: Papaver30_contig00050894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00050894 (492 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009417084.1| PREDICTED: indole-3-acetaldehyde oxidase-lik... 58 3e-06 >ref|XP_009417084.1| PREDICTED: indole-3-acetaldehyde oxidase-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 1393 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 491 TFQLEVPVTMHVVKELCGLDNVERYLKSLVASH 393 +F+LEVP TM VVKELCGLDNVE+YLK+LV+SH Sbjct: 1357 SFRLEVPATMPVVKELCGLDNVEKYLKNLVSSH 1389