BLASTX nr result
ID: Papaver30_contig00050582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00050582 (642 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012474588.1| PREDICTED: leucine-rich repeat receptor prot... 59 3e-06 gb|KHG28899.1| Leucine-rich repeat receptor protein kinase EXS [... 59 3e-06 ref|XP_002273978.2| PREDICTED: leucine-rich repeat receptor prot... 57 7e-06 emb|CAN61953.1| hypothetical protein VITISV_015708 [Vitis vinifera] 57 7e-06 >ref|XP_012474588.1| PREDICTED: leucine-rich repeat receptor protein kinase EMS1 [Gossypium raimondii] gi|763756552|gb|KJB23883.1| hypothetical protein B456_004G120000 [Gossypium raimondii] Length = 1275 Score = 58.5 bits (140), Expect = 3e-06 Identities = 31/58 (53%), Positives = 37/58 (63%) Frame = -1 Query: 174 LDLGNYSFTGAASQRIIYLDQL*RLVLSNNEFIEAIPLKPSSYFQLNNFSYSSFVQHH 1 LDLGN +F+G+ + LDQL LVLS+N +IP KPSSYF N SFVQHH Sbjct: 553 LDLGNNNFSGSIPMELADLDQLQCLVLSHNNLSGSIPWKPSSYFHQANLPDLSFVQHH 610 >gb|KHG28899.1| Leucine-rich repeat receptor protein kinase EXS [Gossypium arboreum] Length = 1275 Score = 58.5 bits (140), Expect = 3e-06 Identities = 31/58 (53%), Positives = 37/58 (63%) Frame = -1 Query: 174 LDLGNYSFTGAASQRIIYLDQL*RLVLSNNEFIEAIPLKPSSYFQLNNFSYSSFVQHH 1 LDLGN +F+G+ + LDQL LVLS+N +IP KPSSYF N SFVQHH Sbjct: 553 LDLGNNNFSGSIPMELADLDQLQCLVLSHNNLSGSIPWKPSSYFHQANLPDLSFVQHH 610 >ref|XP_002273978.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Vitis vinifera] Length = 1301 Score = 57.4 bits (137), Expect = 7e-06 Identities = 32/58 (55%), Positives = 37/58 (63%) Frame = -1 Query: 174 LDLGNYSFTGAASQRIIYLDQL*RLVLSNNEFIEAIPLKPSSYFQLNNFSYSSFVQHH 1 LDLGN G+ RI L QL LVLS+N+ +IP KPSSYF+ N SSFVQHH Sbjct: 579 LDLGNNLLNGSIPDRIADLAQLQCLVLSHNDLSGSIPSKPSSYFRQVNIPDSSFVQHH 636 >emb|CAN61953.1| hypothetical protein VITISV_015708 [Vitis vinifera] Length = 1147 Score = 57.4 bits (137), Expect = 7e-06 Identities = 32/58 (55%), Positives = 37/58 (63%) Frame = -1 Query: 174 LDLGNYSFTGAASQRIIYLDQL*RLVLSNNEFIEAIPLKPSSYFQLNNFSYSSFVQHH 1 LDLGN G+ RI L QL LVLS+N+ +IP KPSSYF+ N SSFVQHH Sbjct: 577 LDLGNNLLNGSIPDRIADLAQLQCLVLSHNDLSGSIPSKPSSYFRQVNIPDSSFVQHH 634