BLASTX nr result
ID: Papaver30_contig00049940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00049940 (584 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009600740.1| PREDICTED: F-box protein At1g78100 [Nicotian... 58 4e-06 ref|XP_009786216.1| PREDICTED: F-box protein At1g78100 [Nicotian... 57 9e-06 >ref|XP_009600740.1| PREDICTED: F-box protein At1g78100 [Nicotiana tomentosiformis] Length = 344 Score = 57.8 bits (138), Expect = 4e-06 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 2/61 (3%) Frame = -1 Query: 584 VVVRPAITDEFERRKNWKSEIEERQEDKELALGAF--DGVFGEAVEALMKRRSYLLEMNS 411 VVVRP ER SE+EE+ D LALGAF D ++GEAVE L+K RSY+LEMNS Sbjct: 289 VVVRPINQGNGER-----SEVEEQNGDVGLALGAFGDDAMYGEAVERLLKSRSYILEMNS 343 Query: 410 F 408 F Sbjct: 344 F 344 >ref|XP_009786216.1| PREDICTED: F-box protein At1g78100 [Nicotiana sylvestris] Length = 345 Score = 56.6 bits (135), Expect = 9e-06 Identities = 35/61 (57%), Positives = 40/61 (65%), Gaps = 2/61 (3%) Frame = -1 Query: 584 VVVRPAITDEFERRKNWKSEIEERQEDKELALGAF--DGVFGEAVEALMKRRSYLLEMNS 411 VVVRP ER SE+EE+ D LAL AF D V+GEAVE L+K RSY+LEMNS Sbjct: 290 VVVRPINQGNGER-----SEVEEQNGDVGLALAAFGDDAVYGEAVERLLKSRSYILEMNS 344 Query: 410 F 408 F Sbjct: 345 F 345