BLASTX nr result
ID: Papaver30_contig00049703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00049703 (579 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQK99152.1| hypothetical protein SETIT_009500mg [Setaria ital... 67 8e-09 ref|XP_008668799.1| PREDICTED: uncharacterized aarF domain-conta... 67 8e-09 ref|XP_008668798.1| PREDICTED: uncharacterized aarF domain-conta... 67 8e-09 tpg|DAA35773.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 67 8e-09 ref|XP_004976991.1| PREDICTED: uncharacterized aarF domain-conta... 67 8e-09 tpg|DAA35774.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 67 8e-09 tpg|DAA35772.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 67 8e-09 tpg|DAA35771.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 67 8e-09 ref|XP_010094885.1| putative aarF domain-containing protein kina... 65 2e-08 ref|XP_011658969.1| PREDICTED: uncharacterized aarF domain-conta... 65 2e-08 ref|XP_011658968.1| PREDICTED: uncharacterized aarF domain-conta... 65 2e-08 gb|KGN44152.1| hypothetical protein Csa_7G207145 [Cucumis sativus] 65 2e-08 ref|XP_008447749.1| PREDICTED: uncharacterized aarF domain-conta... 65 2e-08 ref|XP_008447748.1| PREDICTED: uncharacterized aarF domain-conta... 65 2e-08 ref|XP_008447747.1| PREDICTED: uncharacterized aarF domain-conta... 65 2e-08 ref|XP_002527120.1| Protein ABC1, mitochondrial precursor, putat... 65 2e-08 ref|XP_002447194.1| hypothetical protein SORBIDRAFT_06g030250 [S... 65 2e-08 ref|XP_006652892.1| PREDICTED: uncharacterized aarF domain-conta... 65 2e-08 gb|EMT05965.1| Putative aarF domain-containing protein kinase [A... 65 2e-08 gb|EMS62819.1| hypothetical protein TRIUR3_04048 [Triticum urartu] 65 2e-08 >gb|KQK99152.1| hypothetical protein SETIT_009500mg [Setaria italica] Length = 532 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 364 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 394 >ref|XP_008668799.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic isoform X2 [Zea mays] Length = 630 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 416 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 446 >ref|XP_008668798.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic isoform X1 [Zea mays] Length = 760 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 416 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 446 >tpg|DAA35773.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 442 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 98 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 128 >ref|XP_004976991.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic [Setaria italica] gi|514804235|ref|XP_004976992.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic [Setaria italica] gi|944234791|gb|KQK99153.1| hypothetical protein SETIT_009500mg [Setaria italica] Length = 709 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 364 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 394 >tpg|DAA35774.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 304 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 98 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 128 >tpg|DAA35772.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 521 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 177 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 207 >tpg|DAA35771.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 703 Score = 66.6 bits (161), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+AL Sbjct: 359 DFGMMGEFRQELRDGFIEACLHLVNRDFDAL 389 >ref|XP_010094885.1| putative aarF domain-containing protein kinase [Morus notabilis] gi|587868041|gb|EXB57414.1| putative aarF domain-containing protein kinase [Morus notabilis] Length = 703 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 366 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 396 >ref|XP_011658969.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic isoform X2 [Cucumis sativus] Length = 699 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 370 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 400 >ref|XP_011658968.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic isoform X1 [Cucumis sativus] Length = 703 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 370 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 400 >gb|KGN44152.1| hypothetical protein Csa_7G207145 [Cucumis sativus] Length = 389 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 56 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 86 >ref|XP_008447749.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic isoform X3 [Cucumis melo] Length = 693 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 367 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 397 >ref|XP_008447748.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic isoform X2 [Cucumis melo] Length = 697 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 367 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 397 >ref|XP_008447747.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic isoform X1 [Cucumis melo] Length = 701 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 367 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 397 >ref|XP_002527120.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis] gi|223533543|gb|EEF35283.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis] Length = 711 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEF+QELRDGFIEACLHLVNRDF+AL Sbjct: 367 DFGMMGEFKQELRDGFIEACLHLVNRDFDAL 397 >ref|XP_002447194.1| hypothetical protein SORBIDRAFT_06g030250 [Sorghum bicolor] gi|241938377|gb|EES11522.1| hypothetical protein SORBIDRAFT_06g030250 [Sorghum bicolor] Length = 706 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQ+LRDGFIEACLHLVNRDF+AL Sbjct: 360 DFGMMGEFRQDLRDGFIEACLHLVNRDFDAL 390 >ref|XP_006652892.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Oryza brachyantha] Length = 719 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+ L Sbjct: 375 DFGMMGEFRQELRDGFIEACLHLVNRDFDGL 405 >gb|EMT05965.1| Putative aarF domain-containing protein kinase [Aegilops tauschii] Length = 590 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+ L Sbjct: 237 DFGMMGEFRQELRDGFIEACLHLVNRDFDGL 267 >gb|EMS62819.1| hypothetical protein TRIUR3_04048 [Triticum urartu] Length = 440 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 94 DFGMMGEFRQELRDGFIEACLHLVNRDFNAL 2 DFGMMGEFRQELRDGFIEACLHLVNRDF+ L Sbjct: 84 DFGMMGEFRQELRDGFIEACLHLVNRDFDGL 114