BLASTX nr result
ID: Papaver30_contig00049545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00049545 (581 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012998546.1| PREDICTED: histone H2B type 2-F isoform X1 [... 64 6e-08 ref|XP_003746459.1| PREDICTED: histone H2B.3-like [Metaseiulus o... 63 9e-08 ref|XP_005867477.2| PREDICTED: histone H2B type 2-F [Myotis bran... 62 2e-07 ref|XP_006095228.2| PREDICTED: histone H2B type 2-F-like [Myotis... 62 2e-07 ref|XP_014512746.1| PREDICTED: probable histone H2B.3 [Vigna rad... 62 3e-07 ref|XP_014512419.1| PREDICTED: probable histone H2B.3 [Vigna rad... 62 3e-07 ref|XP_014507207.1| PREDICTED: probable histone H2B.1 [Vigna rad... 62 3e-07 ref|XP_014507023.1| PREDICTED: probable histone H2B.1 isoform X2... 62 3e-07 ref|XP_014499724.1| PREDICTED: probable histone H2B.1 [Vigna rad... 62 3e-07 ref|XP_014522133.1| PREDICTED: uncharacterized protein LOC106778... 62 3e-07 ref|XP_014375690.1| PREDICTED: uncharacterized protein LOC102387... 62 3e-07 ref|XP_013724039.1| PREDICTED: histone H2B.10-like [Brassica napus] 62 3e-07 ref|XP_013712083.1| PREDICTED: histone H2B.11-like [Brassica napus] 62 3e-07 ref|XP_013682136.1| PREDICTED: histone H2B.3-like [Brassica napus] 62 3e-07 ref|XP_013680559.1| PREDICTED: histone H2B.10-like [Brassica napus] 62 3e-07 ref|XP_013676435.1| PREDICTED: histone H2B.3 isoform X2 [Brassic... 62 3e-07 ref|XP_013744195.1| PREDICTED: histone H2B.3-like [Brassica napus] 62 3e-07 ref|XP_013680989.1| PREDICTED: histone H2B.7-like [Brassica napus] 62 3e-07 ref|XP_013625682.1| PREDICTED: histone H2B.10-like [Brassica ole... 62 3e-07 ref|XP_013625457.1| PREDICTED: histone H2B.10-like [Brassica ole... 62 3e-07 >ref|XP_012998546.1| PREDICTED: histone H2B type 2-F isoform X1 [Cavia porcellus] Length = 153 Score = 63.9 bits (154), Expect = 6e-08 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*LESSFEKK 462 IQTAVRL+LPGELAKHAVSEGTKAVTK+TSS L++S++ K Sbjct: 95 IQTAVRLLLPGELAKHAVSEGTKAVTKYTSSNLQNSWDCK 134 >ref|XP_003746459.1| PREDICTED: histone H2B.3-like [Metaseiulus occidentalis] Length = 236 Score = 63.2 bits (152), Expect = 9e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*LESSFEKK 462 +QTAVRL+LPGELAKHAVSEGTKAVTK+TSS SFE++ Sbjct: 93 VQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKFYFSFERR 132 >ref|XP_005867477.2| PREDICTED: histone H2B type 2-F [Myotis brandtii] Length = 159 Score = 62.4 bits (150), Expect = 2e-07 Identities = 34/45 (75%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*LESSF-EKKGVRV 450 IQTAVRL+LPGELAKHAVSEGTKAVTK+TSS L S+ E+ G++V Sbjct: 95 IQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKLYSALPEEVGLKV 139 >ref|XP_006095228.2| PREDICTED: histone H2B type 2-F-like [Myotis lucifugus] Length = 159 Score = 62.4 bits (150), Expect = 2e-07 Identities = 34/45 (75%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*LESSF-EKKGVRV 450 IQTAVRL+LPGELAKHAVSEGTKAVTK+TSS L S+ E+ G++V Sbjct: 95 IQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKLYSALPEEVGLKV 139 >ref|XP_014512746.1| PREDICTED: probable histone H2B.3 [Vigna radiata var. radiata] Length = 135 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 105 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 135 >ref|XP_014512419.1| PREDICTED: probable histone H2B.3 [Vigna radiata var. radiata] Length = 139 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 109 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 139 >ref|XP_014507207.1| PREDICTED: probable histone H2B.1 [Vigna radiata var. radiata] Length = 145 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145 >ref|XP_014507023.1| PREDICTED: probable histone H2B.1 isoform X2 [Vigna radiata var. radiata] Length = 147 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 >ref|XP_014499724.1| PREDICTED: probable histone H2B.1 [Vigna radiata var. radiata] Length = 147 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 >ref|XP_014522133.1| PREDICTED: uncharacterized protein LOC106778661 [Vigna radiata var. radiata] Length = 340 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 310 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 340 >ref|XP_014375690.1| PREDICTED: uncharacterized protein LOC102387935 [Alligator sinensis] Length = 743 Score = 61.6 bits (148), Expect = 3e-07 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*LESSFEKKGVRVQIPCYEIRGR 420 IQTAVRL+LPGELAKHAVSEGTKAVTK+TSS + R+ CYE R Sbjct: 460 IQTAVRLLLPGELAKHAVSEGTKAVTKYTSS--KKKTASFSYRISPMCYEFLWR 511 >ref|XP_013724039.1| PREDICTED: histone H2B.10-like [Brassica napus] Length = 141 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 111 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141 >ref|XP_013712083.1| PREDICTED: histone H2B.11-like [Brassica napus] Length = 147 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147 >ref|XP_013682136.1| PREDICTED: histone H2B.3-like [Brassica napus] Length = 141 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 111 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141 >ref|XP_013680559.1| PREDICTED: histone H2B.10-like [Brassica napus] Length = 141 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 111 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 141 >ref|XP_013676435.1| PREDICTED: histone H2B.3 isoform X2 [Brassica napus] Length = 157 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 127 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 157 >ref|XP_013744195.1| PREDICTED: histone H2B.3-like [Brassica napus] Length = 152 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 122 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 152 >ref|XP_013680989.1| PREDICTED: histone H2B.7-like [Brassica napus] Length = 142 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 142 >ref|XP_013625682.1| PREDICTED: histone H2B.10-like [Brassica oleracea var. oleracea] Length = 142 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 112 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 142 >ref|XP_013625457.1| PREDICTED: histone H2B.10-like [Brassica oleracea var. oleracea] gi|922441013|ref|XP_013625458.1| PREDICTED: histone H2B.10-like [Brassica oleracea var. oleracea] Length = 136 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 581 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 489 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 106 IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 136