BLASTX nr result
ID: Papaver30_contig00047432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00047432 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011027196.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 69 1e-09 ref|XP_002315224.1| glycosyl transferase family 2 family protein... 69 1e-09 gb|KCW65534.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus g... 69 2e-09 ref|XP_010067407.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 69 2e-09 ref|XP_010253173.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 68 3e-09 ref|XP_010253172.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 68 3e-09 ref|XP_009343432.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 68 3e-09 ref|XP_008354133.1| PREDICTED: probable mediator of RNA polymera... 68 3e-09 gb|KNA18514.1| hypothetical protein SOVF_069880 [Spinacia oleracea] 67 5e-09 gb|KJB73916.1| hypothetical protein B456_011G260700 [Gossypium r... 67 5e-09 ref|XP_012454520.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 67 5e-09 ref|XP_006411189.1| hypothetical protein EUTSA_v10016901mg [Eutr... 67 5e-09 emb|CDY53598.1| BnaA05g34710D [Brassica napus] 67 7e-09 gb|KJB60685.1| hypothetical protein B456_009G319400 [Gossypium r... 66 9e-09 ref|XP_012447983.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 66 9e-09 ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases supe... 66 9e-09 ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabi... 66 9e-09 ref|NP_181493.1| putative dolichyl-phosphate beta-glucosyltransf... 66 9e-09 ref|XP_013676828.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 66 1e-08 ref|XP_013748304.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 66 1e-08 >ref|XP_011027196.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Populus euphratica] Length = 335 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 IEISV WSEIPGSKV+L SIP+ML EL LMSVGYRTR+W I Sbjct: 293 IEISVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTRMWKI 333 >ref|XP_002315224.1| glycosyl transferase family 2 family protein [Populus trichocarpa] gi|222864264|gb|EEF01395.1| glycosyl transferase family 2 family protein [Populus trichocarpa] Length = 335 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 IEISV WSEIPGSKV+L SIP+ML EL LMSVGYRTR+W I Sbjct: 293 IEISVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTRMWKI 333 >gb|KCW65534.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus grandis] Length = 325 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +EISV WSEIPGSKV++ SIP+ML EL LMSVGYRTR+W I + Sbjct: 283 VEISVNWSEIPGSKVNMLSIPNMLWELALMSVGYRTRMWKIHS 325 >ref|XP_010067407.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Eucalyptus grandis] gi|629099768|gb|KCW65533.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus grandis] Length = 335 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +EISV WSEIPGSKV++ SIP+ML EL LMSVGYRTR+W I + Sbjct: 293 VEISVNWSEIPGSKVNMLSIPNMLWELALMSVGYRTRMWKIHS 335 >ref|XP_010253173.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Nelumbo nucifera] Length = 335 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 IEISV WSEIPGSKV+ SIP+ML ELCLMSVGYRT +W + Sbjct: 293 IEISVNWSEIPGSKVNPLSIPNMLWELCLMSVGYRTHMWKV 333 >ref|XP_010253172.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Nelumbo nucifera] Length = 339 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 IEISV WSEIPGSKV+ SIP+ML ELCLMSVGYRT +W + Sbjct: 297 IEISVNWSEIPGSKVNPLSIPNMLWELCLMSVGYRTHMWKV 337 >ref|XP_009343432.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Pyrus x bretschneideri] Length = 336 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +EISV WSEIPGSKV+L SIP+ML EL LMSVGYRT +W IR+ Sbjct: 294 LEISVNWSEIPGSKVNLLSIPNMLWELLLMSVGYRTGMWKIRS 336 >ref|XP_008354133.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 37c [Malus domestica] Length = 289 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +EISV WSEIPGSKV+L SIP+ML EL LMSVGYRT +W IR+ Sbjct: 247 LEISVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWKIRS 289 >gb|KNA18514.1| hypothetical protein SOVF_069880 [Spinacia oleracea] Length = 335 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 +EISVTWSEIPGSKV++ SIP+ML EL LMSVGYRT +W I Sbjct: 293 VEISVTWSEIPGSKVNMLSIPNMLWELALMSVGYRTGMWRI 333 >gb|KJB73916.1| hypothetical protein B456_011G260700 [Gossypium raimondii] Length = 246 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +E+SV WSEIPGSKV+L SIP+ML EL LMSVGYRT++W I + Sbjct: 204 LEVSVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTQMWKINS 246 >ref|XP_012454520.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Gossypium raimondii] gi|763806977|gb|KJB73915.1| hypothetical protein B456_011G260700 [Gossypium raimondii] Length = 333 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +E+SV WSEIPGSKV+L SIP+ML EL LMSVGYRT++W I + Sbjct: 291 LEVSVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTQMWKINS 333 >ref|XP_006411189.1| hypothetical protein EUTSA_v10016901mg [Eutrema salsugineum] gi|557112358|gb|ESQ52642.1| hypothetical protein EUTSA_v10016901mg [Eutrema salsugineum] Length = 336 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 +EISV WSEIPGSKVSL SIP+ML EL LMSVGYRT +W I Sbjct: 293 LEISVNWSEIPGSKVSLLSIPNMLWELALMSVGYRTGMWKI 333 >emb|CDY53598.1| BnaA05g34710D [Brassica napus] Length = 333 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 +EISV WSEIPGSKVS+ SIP+ML EL LMSVGYRT LW I Sbjct: 290 LEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGLWKI 330 >gb|KJB60685.1| hypothetical protein B456_009G319400 [Gossypium raimondii] Length = 325 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +EISV WSEIPGSKV+ SIP+ML EL LMSVGYRTR+W I + Sbjct: 283 LEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRIWKINS 325 >ref|XP_012447983.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Gossypium raimondii] gi|763793686|gb|KJB60682.1| hypothetical protein B456_009G319400 [Gossypium raimondii] Length = 335 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +EISV WSEIPGSKV+ SIP+ML EL LMSVGYRTR+W I + Sbjct: 293 LEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRIWKINS 335 >ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] gi|508726256|gb|EOY18153.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] Length = 335 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 318 +EISV WSEIPGSKV+ SIP+ML EL LMSVGYRTR+W I + Sbjct: 293 LEISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRMWKINS 335 >ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] gi|297327505|gb|EFH57925.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 +EISV WSEIPGSKVS+ SIP+ML EL LMSVGYRT +W I Sbjct: 293 VEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|NP_181493.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|15810211|gb|AAL07006.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|18700244|gb|AAL77732.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|20197112|gb|AAM14922.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|330254605|gb|AEC09699.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|591402142|gb|AHL38798.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 336 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 +EISV WSEIPGSKVS+ SIP+ML EL LMSVGYRT +W I Sbjct: 293 VEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_013676828.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Brassica napus] gi|923801286|ref|XP_013687468.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Brassica napus] Length = 334 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 +EISV WSEIPGSKVS+ SIP+ML EL LMSVGYRT +W I Sbjct: 291 LEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 331 >ref|XP_013748304.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Brassica napus] Length = 333 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 446 IEISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 324 +EISV WSEIPGSKVS+ SIP+ML EL LMSVGYRT +W I Sbjct: 290 LEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 330