BLASTX nr result
ID: Papaver30_contig00046890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00046890 (1042 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007008770.1| Pentatricopeptide repeat (PPR-like) superfam... 74 2e-10 ref|XP_012449113.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-10 gb|KJB67470.1| hypothetical protein B456_010G192200 [Gossypium r... 74 3e-10 ref|XP_010106422.1| hypothetical protein L484_008628 [Morus nota... 73 3e-10 ref|XP_010645700.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-10 emb|CDP12559.1| unnamed protein product [Coffea canephora] 71 2e-09 ref|XP_010255813.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-09 gb|KDO83244.1| hypothetical protein CISIN_1g006744mg [Citrus sin... 70 2e-09 ref|XP_012569772.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-09 ref|XP_012069204.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-09 ref|XP_008238545.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 69 5e-09 ref|XP_008231523.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 69 5e-09 gb|KRH55198.1| hypothetical protein GLYMA_06G236700 [Glycine max] 69 6e-09 gb|KRG90809.1| hypothetical protein GLYMA_20G115000 [Glycine max] 69 6e-09 gb|KHN23162.1| Pentatricopeptide repeat-containing protein [Glyc... 69 6e-09 gb|KHN11425.1| Pentatricopeptide repeat-containing protein [Glyc... 69 6e-09 ref|XP_009788856.1| PREDICTED: pentatricopeptide repeat-containi... 69 6e-09 ref|XP_006605814.1| PREDICTED: pentatricopeptide repeat-containi... 69 6e-09 ref|XP_004511291.1| PREDICTED: pentatricopeptide repeat-containi... 69 6e-09 ref|XP_010537374.1| PREDICTED: pentatricopeptide repeat-containi... 69 8e-09 >ref|XP_007008770.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508725683|gb|EOY17580.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 716 Score = 73.9 bits (180), Expect = 2e-10 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVIT 875 F+ LR RKLL+EAN IVYDE+LI H +KK A LV + LKFFGLESK+K K ST+++ Sbjct: 660 FANLRTRKLLTEANTIVYDEILIEHMEKKAAELVLSGLKFFGLESKLKAKGSTLLS 715 >ref|XP_012449113.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Gossypium raimondii] gi|823232893|ref|XP_012449114.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Gossypium raimondii] gi|763800516|gb|KJB67471.1| hypothetical protein B456_010G192200 [Gossypium raimondii] Length = 718 Score = 73.6 bits (179), Expect = 3e-10 Identities = 35/56 (62%), Positives = 46/56 (82%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVIT 875 F+ LR RKLL+EAN+I+YDELLI + +KK A LV + LKFFGLESK+K K ST+++ Sbjct: 662 FANLRTRKLLTEANIIIYDELLIEYMEKKAADLVLSGLKFFGLESKLKAKGSTLLS 717 >gb|KJB67470.1| hypothetical protein B456_010G192200 [Gossypium raimondii] Length = 590 Score = 73.6 bits (179), Expect = 3e-10 Identities = 35/56 (62%), Positives = 46/56 (82%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVIT 875 F+ LR RKLL+EAN+I+YDELLI + +KK A LV + LKFFGLESK+K K ST+++ Sbjct: 534 FANLRTRKLLTEANIIIYDELLIEYMEKKAADLVLSGLKFFGLESKLKAKGSTLLS 589 >ref|XP_010106422.1| hypothetical protein L484_008628 [Morus notabilis] gi|587923100|gb|EXC10461.1| hypothetical protein L484_008628 [Morus notabilis] Length = 716 Score = 73.2 bits (178), Expect = 3e-10 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR RKL+SEA IVYDE+LI+H +KK A LV + LKFFGLESK+K K ST++++ Sbjct: 660 FSNLRERKLMSEARTIVYDEILIDHMKKKTADLVVSGLKFFGLESKLKAKGSTLLSN 716 >ref|XP_010645700.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] gi|296081308|emb|CBI17752.3| unnamed protein product [Vitis vinifera] Length = 729 Score = 72.4 bits (176), Expect = 6e-10 Identities = 35/55 (63%), Positives = 45/55 (81%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVI 878 FS +R RKLL+EAN+IVYDE+LI H +KK A LV + LKFFGLESK++ K ST++ Sbjct: 665 FSNMRERKLLTEANVIVYDEILIEHMKKKTADLVLSGLKFFGLESKLRSKGSTLL 719 >emb|CDP12559.1| unnamed protein product [Coffea canephora] Length = 727 Score = 70.9 bits (172), Expect = 2e-09 Identities = 35/55 (63%), Positives = 45/55 (81%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVI 878 F GLR R+LLSEA++IVYDELLI+H +KK A LV + LKFFGLE K+K + ST++ Sbjct: 671 FVGLRERQLLSEADVIVYDELLIDHMKKKTADLVLSGLKFFGLEKKLKARGSTLL 725 >ref|XP_010255813.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Nelumbo nucifera] gi|719965226|ref|XP_010255821.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Nelumbo nucifera] Length = 733 Score = 70.5 bits (171), Expect = 2e-09 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS ++ R LL+EAN+IVYDE LI+H +KK AGLV + LKFFGLESK+K K ++ S Sbjct: 677 FSSMKDRSLLTEANMIVYDEFLIDHMKKKTAGLVLSGLKFFGLESKLKSKGCRILLS 733 >gb|KDO83244.1| hypothetical protein CISIN_1g006744mg [Citrus sinensis] Length = 632 Score = 70.5 bits (171), Expect = 2e-09 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 F+ LR RKLL+EAN IVYDE+LI H +KK A LV + LKFFGLESK+K K +++S Sbjct: 576 FTNLRERKLLTEANTIVYDEILIEHMKKKTADLVLSGLKFFGLESKLKAKGCKLLSS 632 >ref|XP_012569772.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302886|ref|XP_012569773.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302888|ref|XP_012569774.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302890|ref|XP_012569775.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302892|ref|XP_012569776.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 70.1 bits (170), Expect = 3e-09 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR RKLL+E++ IVYDELLI+H +KK A LV + LKFFGLESK+KLK ++ S Sbjct: 664 FSNLRDRKLLTESDTIVYDELLIDHMKKKTADLVISGLKFFGLESKLKLKGCKLLPS 720 >ref|XP_012069204.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Jatropha curcas] Length = 1159 Score = 69.7 bits (169), Expect = 4e-09 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 F+ +R RKLL+EA IVYDE+LI H +KK A LV + LKFFGLESK+K K T+++S Sbjct: 1103 FTSMRERKLLTEAKTIVYDEILIEHMKKKTADLVLSGLKFFGLESKLKAKGCTLLSS 1159 >ref|XP_008238545.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g20740-like [Prunus mume] Length = 719 Score = 69.3 bits (168), Expect = 5e-09 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVIT 875 FS L+ RKLL+EAN+IVYDE+LI H +KK A LV + LKFFGLESK+K K +++ Sbjct: 663 FSNLKERKLLTEANVIVYDEVLIEHMKKKTADLVVSGLKFFGLESKLKAKGCKLLS 718 >ref|XP_008231523.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g20740-like [Prunus mume] Length = 720 Score = 69.3 bits (168), Expect = 5e-09 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVIT 875 FS L+ RKLL+EAN+IVYDE+LI H +KK A LV + LKFFGLESK+K K +++ Sbjct: 664 FSNLKERKLLTEANVIVYDEVLIEHMKKKTADLVVSGLKFFGLESKLKAKGCKLLS 719 >gb|KRH55198.1| hypothetical protein GLYMA_06G236700 [Glycine max] Length = 764 Score = 68.9 bits (167), Expect = 6e-09 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR R L+E+N IVYDELLI+H +KK A LV +SLKFFGLESK+K K ++ S Sbjct: 708 FSNLRERNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLKAKGCKLLPS 764 >gb|KRG90809.1| hypothetical protein GLYMA_20G115000 [Glycine max] Length = 695 Score = 68.9 bits (167), Expect = 6e-09 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR R L+E+N IVYDELLI+H +KK A LV +SLKFFGLESK+K K ++ S Sbjct: 639 FSNLRERNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLKAKGCKLLPS 695 >gb|KHN23162.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 680 Score = 68.9 bits (167), Expect = 6e-09 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR R L+E+N IVYDELLI+H +KK A LV +SLKFFGLESK+K K ++ S Sbjct: 624 FSNLRERNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLKAKGCKLLPS 680 >gb|KHN11425.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 425 Score = 68.9 bits (167), Expect = 6e-09 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR R L+E+N IVYDELLI+H +KK A LV +SLKFFGLESK+K K ++ S Sbjct: 369 FSNLRERNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLKAKGCKLLPS 425 >ref|XP_009788856.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Nicotiana sylvestris] Length = 721 Score = 68.9 bits (167), Expect = 6e-09 Identities = 33/55 (60%), Positives = 45/55 (81%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVI 878 F+ +R RK L+EA+L+VYDE+LI+H +KK A LV + LKFFGLESK+K K ST++ Sbjct: 665 FANMRKRKHLTEADLVVYDEVLIDHMKKKTADLVLSGLKFFGLESKLKAKGSTLL 719 >ref|XP_006605814.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like isoform X2 [Glycine max] gi|571565751|ref|XP_003555182.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like isoform X1 [Glycine max] gi|947040805|gb|KRG90529.1| hypothetical protein GLYMA_20G097200 [Glycine max] gi|947040806|gb|KRG90530.1| hypothetical protein GLYMA_20G097200 [Glycine max] Length = 764 Score = 68.9 bits (167), Expect = 6e-09 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR R L+E+N IVYDELLI+H +KK A LV +SLKFFGLESK+K K ++ S Sbjct: 708 FSNLRERNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLKAKGCKLLPS 764 >ref|XP_004511291.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330040|ref|XP_004511445.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330043|ref|XP_012574365.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330046|ref|XP_012574366.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330051|ref|XP_012574367.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330054|ref|XP_012574368.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 68.9 bits (167), Expect = 6e-09 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVITS 872 FS LR RKLL+E++ IVYDELLI+H +KK A LV + LKFFGLESK+K K V+ S Sbjct: 664 FSNLRDRKLLTESDTIVYDELLIDHMKKKTADLVISGLKFFGLESKLKSKGCKVLPS 720 >ref|XP_010537374.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 isoform X2 [Tarenaya hassleriana] Length = 698 Score = 68.6 bits (166), Expect = 8e-09 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -1 Query: 1042 FSGLRVRKLLSEANLIVYDELLINHTQKKMAGLVQASLKFFGLESKVKLKSSTVI 878 F+ L+ RKLL+EA++IVYDE+LI H QKK A LV A LKFFGLESK+K K ++ Sbjct: 642 FTELKSRKLLTEADMIVYDEMLIEHMQKKTADLVLAGLKFFGLESKLKAKGCRLL 696