BLASTX nr result
ID: Papaver30_contig00046811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00046811 (748 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010251848.1| PREDICTED: cell division control protein 48 ... 60 2e-06 ref|XP_007034004.1| Cell division control protein 48 C isoform 3... 58 8e-06 ref|XP_007034002.1| Cell division control protein 48 C isoform 1... 58 8e-06 >ref|XP_010251848.1| PREDICTED: cell division control protein 48 homolog C [Nelumbo nucifera] Length = 826 Score = 60.1 bits (144), Expect = 2e-06 Identities = 41/85 (48%), Positives = 52/85 (61%), Gaps = 5/85 (5%) Frame = +1 Query: 508 GKGSLPSTSPFVLRR-----RIESCKLSKLRVDEIVERLQTNFPDYKRQKVAPFTKCVQR 672 G+ S SP VL R R+ESCK +K DEIV+ L++N+PDY+R K PF+K VQ+ Sbjct: 2 GRRSFGGRSPSVLDRSVILRRLESCK-NKSTFDEIVDYLRSNYPDYRRIKQQPFSKYVQQ 60 Query: 673 ALLVQQGRRNFSASPSIKGSDYHDD 747 L QQ R+ SAS S G D DD Sbjct: 61 TLEFQQ-RKKLSASTS-NGIDDDDD 83 >ref|XP_007034004.1| Cell division control protein 48 C isoform 3 [Theobroma cacao] gi|508713033|gb|EOY04930.1| Cell division control protein 48 C isoform 3 [Theobroma cacao] Length = 729 Score = 57.8 bits (138), Expect = 8e-06 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 7/87 (8%) Frame = +1 Query: 508 GKGSLPSTSPF------VLRRRIESCK-LSKLRVDEIVERLQTNFPDYKRQKVAPFTKCV 666 G G PS+S +L RR+ SC+ + VDEIVE LQTN+PDY+R K P T+ V Sbjct: 6 GVGRSPSSSSSSVLNQKILSRRLSSCQQYAGSTVDEIVELLQTNYPDYRRIKKQPLTRVV 65 Query: 667 QRALLVQQGRRNFSASPSIKGSDYHDD 747 ++AL Q S S+ SD++ D Sbjct: 66 KQALQALQSSSKNSQKASLSVSDFNFD 92 >ref|XP_007034002.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|590655493|ref|XP_007034003.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508713031|gb|EOY04928.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508713032|gb|EOY04929.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] Length = 840 Score = 57.8 bits (138), Expect = 8e-06 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 7/87 (8%) Frame = +1 Query: 508 GKGSLPSTSPF------VLRRRIESCK-LSKLRVDEIVERLQTNFPDYKRQKVAPFTKCV 666 G G PS+S +L RR+ SC+ + VDEIVE LQTN+PDY+R K P T+ V Sbjct: 6 GVGRSPSSSSSSVLNQKILSRRLSSCQQYAGSTVDEIVELLQTNYPDYRRIKKQPLTRVV 65 Query: 667 QRALLVQQGRRNFSASPSIKGSDYHDD 747 ++AL Q S S+ SD++ D Sbjct: 66 KQALQALQSSSKNSQKASLSVSDFNFD 92