BLASTX nr result
ID: Papaver30_contig00045394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00045394 (1917 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002259198.1| hypothetical protein, conserved in Plasmodiu... 60 7e-06 >ref|XP_002259198.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] gi|193809269|emb|CAQ39971.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] Length = 721 Score = 60.1 bits (144), Expect = 7e-06 Identities = 35/117 (29%), Positives = 50/117 (42%), Gaps = 8/117 (6%) Frame = +1 Query: 1591 HCQAYHPKQRCRHSQHQQKEHHRFGTLVNYLHCQTYHRKLRPLQIQHQQ--------KEY 1746 H Q H +Q H QK HH+ LH Q +H++ Q HQQ ++ Sbjct: 274 HHQQNHHQQNHHQQNHHQKNHHQQNLHQQNLHQQKHHQQNLHQQNLHQQNLHQQNHHQQN 333 Query: 1747 HWAYDLHCQKYHPWVHHRCLPSSQNYHHYHLLSQKYHPCLPQTRNYHYFQHQQKEYH 1917 H +LH Q H HH+ QN+H +L Q H +N+H H Q+ +H Sbjct: 334 HHQQNLHQQNLHQQNHHQQNLHQQNHHQQNLHQQNLHQQNHHQQNHHQQNHHQQNHH 390