BLASTX nr result
ID: Papaver30_contig00045393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00045393 (720 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534735.1| PREDICTED: inositol transporter 4-like [Glyc... 57 9e-06 >ref|XP_003534735.1| PREDICTED: inositol transporter 4-like [Glycine max] gi|734420431|gb|KHN40818.1| Inositol transporter 4 [Glycine soja] gi|947087898|gb|KRH36563.1| hypothetical protein GLYMA_09G011400 [Glycine max] gi|947087899|gb|KRH36564.1| hypothetical protein GLYMA_09G011400 [Glycine max] gi|947087900|gb|KRH36565.1| hypothetical protein GLYMA_09G011400 [Glycine max] Length = 577 Score = 57.4 bits (137), Expect = 9e-06 Identities = 37/95 (38%), Positives = 53/95 (55%), Gaps = 1/95 (1%) Frame = -2 Query: 317 WVNDCLGRKCSXXXXXXXXXXXXXXLVLLLSIGDSGLYSNYFLETTGNIFIAFGVGMAST 138 W+ND LGRK + L++S+ S ++ G +F+ GVGMAS Sbjct: 86 WINDKLGRKRTILVADVVFFIG----ALVMSLAPSP-----WVIIVGRVFVGLGVGMASM 136 Query: 137 SSPLYISESSPPKLRDILVSIN-FIFYGVGKLTFL 36 ++PLYISE+SP K+R LVSIN F+ G L++L Sbjct: 137 TAPLYISEASPAKIRGALVSINAFLITGGQFLSYL 171