BLASTX nr result
ID: Papaver30_contig00045133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00045133 (453 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278149.1| PREDICTED: magnesium transporter MRS2-I-like... 61 3e-07 ref|XP_012842708.1| PREDICTED: LOW QUALITY PROTEIN: magnesium tr... 60 5e-07 gb|EYU33006.1| hypothetical protein MIMGU_mgv1a008815mg [Erythra... 60 5e-07 ref|XP_008235320.1| PREDICTED: magnesium transporter MRS2-I-like... 60 8e-07 ref|XP_007199897.1| hypothetical protein PRUPE_ppa006624mg [Prun... 60 8e-07 emb|CDP03699.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_010917593.1| PREDICTED: magnesium transporter MRS2-I-like... 59 1e-06 ref|XP_010069171.1| PREDICTED: magnesium transporter MRS2-I-like... 59 2e-06 ref|XP_010069170.1| PREDICTED: magnesium transporter MRS2-I-like... 59 2e-06 gb|KCW57433.1| hypothetical protein EUGRSUZ_H00214 [Eucalyptus g... 59 2e-06 ref|XP_010069167.1| PREDICTED: magnesium transporter MRS2-I-like... 59 2e-06 ref|XP_009354888.1| PREDICTED: magnesium transporter MRS2-I-like... 58 2e-06 ref|XP_009354887.1| PREDICTED: magnesium transporter MRS2-I-like... 58 2e-06 ref|XP_008372315.1| PREDICTED: magnesium transporter MRS2-I-like... 58 2e-06 ref|XP_011029888.1| PREDICTED: magnesium transporter MRS2-2 [Pop... 58 3e-06 ref|XP_002311660.1| magnesium transporter CorA-like family prote... 58 3e-06 ref|XP_010932874.1| PREDICTED: magnesium transporter MRS2-I-like... 57 4e-06 ref|XP_010649991.1| PREDICTED: magnesium transporter MRS2-2 isof... 57 4e-06 ref|XP_010274191.1| PREDICTED: magnesium transporter MRS2-I-like... 57 4e-06 ref|XP_008382950.1| PREDICTED: magnesium transporter MRS2-I-like... 57 4e-06 >ref|XP_010278149.1| PREDICTED: magnesium transporter MRS2-I-like [Nelumbo nucifera] gi|720071740|ref|XP_010278150.1| PREDICTED: magnesium transporter MRS2-I-like [Nelumbo nucifera] Length = 391 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWVVIL+G+VCASLFVLIISYAR+KGLVGS Sbjct: 360 VFKWVVILTGIVCASLFVLIISYARYKGLVGS 391 >ref|XP_012842708.1| PREDICTED: LOW QUALITY PROTEIN: magnesium transporter MRS2-I-like [Erythranthe guttatus] Length = 409 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWVV+L+G++CA LFVLIISYARHKGLVGS Sbjct: 378 VFKWVVVLTGIICAVLFVLIISYARHKGLVGS 409 >gb|EYU33006.1| hypothetical protein MIMGU_mgv1a008815mg [Erythranthe guttata] Length = 361 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWVV+L+G++CA LFVLIISYARHKGLVGS Sbjct: 330 VFKWVVVLTGIICAVLFVLIISYARHKGLVGS 361 >ref|XP_008235320.1| PREDICTED: magnesium transporter MRS2-I-like [Prunus mume] Length = 402 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWV+I++GVVCASLF+ IISYARHKGLVGS Sbjct: 371 IFKWVIIVTGVVCASLFLFIISYARHKGLVGS 402 >ref|XP_007199897.1| hypothetical protein PRUPE_ppa006624mg [Prunus persica] gi|462395297|gb|EMJ01096.1| hypothetical protein PRUPE_ppa006624mg [Prunus persica] Length = 402 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWV+I++GVVCASLF+ IISYARHKGLVGS Sbjct: 371 VFKWVIIVTGVVCASLFLFIISYARHKGLVGS 402 >emb|CDP03699.1| unnamed protein product [Coffea canephora] Length = 390 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVIL+G+ CAS+F+ +ISYARHKGLVGS Sbjct: 359 MFKWVVILTGIACASIFLFLISYARHKGLVGS 390 >ref|XP_010917593.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis] Length = 390 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWVVI+SG+VCA LF+LI++YARHKGLVGS Sbjct: 359 VFKWVVIISGLVCAILFILIVAYARHKGLVGS 390 >ref|XP_010069171.1| PREDICTED: magnesium transporter MRS2-I-like isoform X2 [Eucalyptus grandis] Length = 383 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVI++G+ CA LF+LII+YARHKGLVGS Sbjct: 352 MFKWVVIVTGIACAFLFILIIAYARHKGLVGS 383 >ref|XP_010069170.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Eucalyptus grandis] gi|629091439|gb|KCW57434.1| hypothetical protein EUGRSUZ_H00214 [Eucalyptus grandis] Length = 394 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVI++G+ CA LF+LII+YARHKGLVGS Sbjct: 363 MFKWVVIVTGIACAFLFILIIAYARHKGLVGS 394 >gb|KCW57433.1| hypothetical protein EUGRSUZ_H00214 [Eucalyptus grandis] Length = 379 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVI++G+ CA LF+LII+YARHKGLVGS Sbjct: 348 MFKWVVIVTGIACAFLFILIIAYARHKGLVGS 379 >ref|XP_010069167.1| PREDICTED: magnesium transporter MRS2-I-like [Eucalyptus grandis] gi|629091436|gb|KCW57431.1| hypothetical protein EUGRSUZ_H00212 [Eucalyptus grandis] Length = 413 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVI++G+ CA LF+LII+YARHKGLVGS Sbjct: 382 MFKWVVIVTGIACAFLFILIIAYARHKGLVGS 413 >ref|XP_009354888.1| PREDICTED: magnesium transporter MRS2-I-like isoform X2 [Pyrus x bretschneideri] Length = 406 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWV+I++G+VC S+F+LIISYARHKGLVGS Sbjct: 375 VFKWVIIVTGIVCGSVFLLIISYARHKGLVGS 406 >ref|XP_009354887.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Pyrus x bretschneideri] Length = 407 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWV+I++G+VC S+F+LIISYARHKGLVGS Sbjct: 376 VFKWVIIVTGIVCGSVFLLIISYARHKGLVGS 407 >ref|XP_008372315.1| PREDICTED: magnesium transporter MRS2-I-like [Malus domestica] Length = 406 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWV+I++G+VC S+F+LIISYARHKGLVGS Sbjct: 375 VFKWVIIVTGIVCGSVFLLIISYARHKGLVGS 406 >ref|XP_011029888.1| PREDICTED: magnesium transporter MRS2-2 [Populus euphratica] Length = 394 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVI++GV CASLF+++++YARHKGLVGS Sbjct: 363 MFKWVVIVTGVFCASLFIVLMTYARHKGLVGS 394 >ref|XP_002311660.1| magnesium transporter CorA-like family protein [Populus trichocarpa] gi|222851480|gb|EEE89027.1| magnesium transporter CorA-like family protein [Populus trichocarpa] Length = 394 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVI++GV CASLF+++++YARHKGLVGS Sbjct: 363 MFKWVVIVTGVFCASLFIVLMTYARHKGLVGS 394 >ref|XP_010932874.1| PREDICTED: magnesium transporter MRS2-I-like [Elaeis guineensis] Length = 389 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWVVI+SG+ CA LF+LI++YARHKGLVGS Sbjct: 358 IFKWVVIISGLACAILFILIVAYARHKGLVGS 389 >ref|XP_010649991.1| PREDICTED: magnesium transporter MRS2-2 isoform X2 [Vitis vinifera] Length = 364 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 MFKWVVI++GV CA LFV+I+SYARHKGLVGS Sbjct: 333 MFKWVVIVTGVSCALLFVVIMSYARHKGLVGS 364 >ref|XP_010274191.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Nelumbo nucifera] gi|720058146|ref|XP_010274192.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Nelumbo nucifera] Length = 391 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWVVIL+G+ CA LFVLI+SYAR+KGLVGS Sbjct: 360 VFKWVVILTGIACACLFVLIVSYARYKGLVGS 391 >ref|XP_008382950.1| PREDICTED: magnesium transporter MRS2-I-like [Malus domestica] Length = 407 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/32 (75%), Positives = 32/32 (100%) Frame = -1 Query: 453 MFKWVVILSGVVCASLFVLIISYARHKGLVGS 358 +FKWV+I++G+VCASLF+LI+SYA+HKGLVGS Sbjct: 376 VFKWVIIVTGMVCASLFLLIMSYAQHKGLVGS 407