BLASTX nr result
ID: Papaver30_contig00043113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00043113 (486 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010912484.1| PREDICTED: CBS domain-containing protein CBS... 66 1e-08 ref|XP_010912483.1| PREDICTED: CBS domain-containing protein CBS... 66 1e-08 ref|XP_010912482.1| PREDICTED: CBS domain-containing protein CBS... 66 1e-08 gb|KDO52200.1| hypothetical protein CISIN_1g038065mg [Citrus sin... 66 1e-08 ref|XP_006432072.1| hypothetical protein CICLE_v10000793mg [Citr... 66 1e-08 ref|XP_004309727.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-c... 64 4e-08 ref|XP_011031089.1| PREDICTED: CBS domain-containing protein CBS... 63 8e-08 ref|XP_011031088.1| PREDICTED: CBS domain-containing protein CBS... 63 8e-08 ref|XP_002306284.2| hypothetical protein POPTR_0005s07150g [Popu... 63 8e-08 ref|XP_004146397.1| PREDICTED: CBS domain-containing protein CBS... 62 2e-07 ref|XP_008442154.1| PREDICTED: CBS domain-containing protein CBS... 62 2e-07 ref|XP_010099759.1| CBS domain-containing protein [Morus notabil... 61 3e-07 ref|XP_009416910.1| PREDICTED: CBS domain-containing protein CBS... 61 3e-07 emb|CBI21626.3| unnamed protein product [Vitis vinifera] 61 3e-07 ref|XP_002272502.1| PREDICTED: CBS domain-containing protein CBS... 61 3e-07 ref|XP_011022844.1| PREDICTED: CBS domain-containing protein CBS... 61 4e-07 ref|XP_002309952.2| hypothetical protein POPTR_0007s04880g [Popu... 61 4e-07 ref|XP_010025715.1| PREDICTED: CBS domain-containing protein CBS... 60 5e-07 ref|XP_007048556.1| CBS / octicosapeptide/Phox/Bemp1 domains-con... 60 6e-07 ref|XP_007048555.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domai... 60 6e-07 >ref|XP_010912484.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform X3 [Elaeis guineensis] Length = 519 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINK 338 NSFAFKFEDRKGRVHR NCGTE+L ELVS +MQ ++G+DT K Sbjct: 385 NSFAFKFEDRKGRVHRFNCGTESLAELVSAIMQ------RIGLDTDAEK 427 >ref|XP_010912483.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform X2 [Elaeis guineensis] Length = 546 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINK 338 NSFAFKFEDRKGRVHR NCGTE+L ELVS +MQ ++G+DT K Sbjct: 412 NSFAFKFEDRKGRVHRFNCGTESLAELVSAIMQ------RIGLDTDAEK 454 >ref|XP_010912482.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform X1 [Elaeis guineensis] Length = 549 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINK 338 NSFAFKFEDRKGRVHR NCGTE+L ELVS +MQ ++G+DT K Sbjct: 415 NSFAFKFEDRKGRVHRFNCGTESLAELVSAIMQ------RIGLDTDAEK 457 >gb|KDO52200.1| hypothetical protein CISIN_1g038065mg [Citrus sinensis] Length = 182 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFEDRKGRVHR NCGTEN++EL+STVMQ Sbjct: 47 NSFAFKFEDRKGRVHRFNCGTENVDELLSTVMQ 79 >ref|XP_006432072.1| hypothetical protein CICLE_v10000793mg [Citrus clementina] gi|568820913|ref|XP_006464944.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Citrus sinensis] gi|557534194|gb|ESR45312.1| hypothetical protein CICLE_v10000793mg [Citrus clementina] Length = 540 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFEDRKGRVHR NCGTEN++EL+STVMQ Sbjct: 405 NSFAFKFEDRKGRVHRFNCGTENVDELLSTVMQ 437 >ref|XP_004309727.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein CBSCBSPB3-like [Fragaria vesca subsp. vesca] Length = 541 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFEDRKGRVHRLN GTENL+ELVS VMQ Sbjct: 408 NSFAFKFEDRKGRVHRLNSGTENLDELVSAVMQ 440 >ref|XP_011031089.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform X2 [Populus euphratica] Length = 503 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINKWNEPLVL 317 NSFAFKF+D KGRVHRLNCGTENL EL+STV+Q ++G D N+ + P +L Sbjct: 420 NSFAFKFQDLKGRVHRLNCGTENLNELLSTVLQ------RIGAD---NEQDRPQLL 466 >ref|XP_011031088.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform X1 [Populus euphratica] Length = 555 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINKWNEPLVL 317 NSFAFKF+D KGRVHRLNCGTENL EL+STV+Q ++G D N+ + P +L Sbjct: 420 NSFAFKFQDLKGRVHRLNCGTENLNELLSTVLQ------RIGAD---NEQDRPQLL 466 >ref|XP_002306284.2| hypothetical protein POPTR_0005s07150g [Populus trichocarpa] gi|118489093|gb|ABK96353.1| unknown [Populus trichocarpa x Populus deltoides] gi|550338308|gb|EEE93280.2| hypothetical protein POPTR_0005s07150g [Populus trichocarpa] Length = 555 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINKWNEPLVL 317 NSFAFKF+D KGRVHRLNCGTENL EL+STV+Q ++G D N+ + P +L Sbjct: 420 NSFAFKFQDLKGRVHRLNCGTENLNELLSTVLQ------RIGAD---NEQDRPQLL 466 >ref|XP_004146397.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Cucumis sativus] gi|700199622|gb|KGN54780.1| hypothetical protein Csa_4G495220 [Cucumis sativus] Length = 539 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINKWNEPLVL 317 NSFAFKFED KGRVHR+NCGTE L+ELVS VMQ ++G + N+ PL+L Sbjct: 406 NSFAFKFEDLKGRVHRVNCGTETLDELVSVVMQ------RIGATDSANR---PLLL 452 >ref|XP_008442154.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Cucumis melo] Length = 539 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFED KGRVHR+NCGTE L+ELVS VMQ Sbjct: 406 NSFAFKFEDLKGRVHRVNCGTETLDELVSVVMQ 438 >ref|XP_010099759.1| CBS domain-containing protein [Morus notabilis] gi|587891769|gb|EXB80377.1| CBS domain-containing protein [Morus notabilis] Length = 537 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 N+F+FKFED KGRVHRLNCGTE+L+EL+STVMQ Sbjct: 404 NTFSFKFEDFKGRVHRLNCGTESLDELLSTVMQ 436 >ref|XP_009416910.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Musa acuminata subsp. malaccensis] Length = 549 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQLEEHLSQVGVDTTINK 338 NSFAFK ED KG +HR NCGT+NL+ELVS VMQ ++G+D NK Sbjct: 416 NSFAFKIEDGKGHIHRFNCGTDNLDELVSAVMQ------RIGLDADANK 458 >emb|CBI21626.3| unnamed protein product [Vitis vinifera] Length = 556 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFED KGRVHR NCGTE+L+ELVS VMQ Sbjct: 422 NSFAFKFEDIKGRVHRFNCGTESLDELVSAVMQ 454 >ref|XP_002272502.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Vitis vinifera] gi|731397648|ref|XP_010652950.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Vitis vinifera] Length = 539 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFED KGRVHR NCGTE+L+ELVS VMQ Sbjct: 405 NSFAFKFEDIKGRVHRFNCGTESLDELVSAVMQ 437 >ref|XP_011022844.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Populus euphratica] Length = 550 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFED KGR+HRLNC TENL+EL+STV+Q Sbjct: 416 NSFAFKFEDLKGRIHRLNCCTENLDELLSTVLQ 448 >ref|XP_002309952.2| hypothetical protein POPTR_0007s04880g [Populus trichocarpa] gi|550334152|gb|EEE90402.2| hypothetical protein POPTR_0007s04880g [Populus trichocarpa] Length = 551 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFED KGR+HRLNC TENL+EL+STV+Q Sbjct: 416 NSFAFKFEDLKGRIHRLNCCTENLDELLSTVLQ 448 >ref|XP_010025715.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Eucalyptus grandis] gi|629096438|gb|KCW62433.1| hypothetical protein EUGRSUZ_H05076 [Eucalyptus grandis] Length = 551 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVMQ 386 NSFAFKFED KGR+H+LNCGTENL+EL+S V+Q Sbjct: 416 NSFAFKFEDLKGRMHKLNCGTENLDELLSAVLQ 448 >ref|XP_007048556.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform 2 [Theobroma cacao] gi|508700817|gb|EOX92713.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform 2 [Theobroma cacao] Length = 474 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVM 389 NSFAFKFED KGRVHR NCGTENL+EL+S +M Sbjct: 342 NSFAFKFEDLKGRVHRFNCGTENLDELLSAIM 373 >ref|XP_007048555.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein isoform 1 [Theobroma cacao] gi|508700816|gb|EOX92712.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein isoform 1 [Theobroma cacao] Length = 532 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 484 NSFAFKFEDRKGRVHRLNCGTENLEELVSTVM 389 NSFAFKFED KGRVHR NCGTENL+EL+S +M Sbjct: 400 NSFAFKFEDLKGRVHRFNCGTENLDELLSAIM 431