BLASTX nr result
ID: Papaver30_contig00041990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00041990 (550 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010249261.1| PREDICTED: WASH complex subunit strumpellin ... 56 9e-06 >ref|XP_010249261.1| PREDICTED: WASH complex subunit strumpellin homolog [Nelumbo nucifera] Length = 1153 Score = 56.2 bits (134), Expect = 9e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -3 Query: 545 WMMFFCKHMEIPKDVVDSCIPPSLIAVLQV 456 W+M+FC HME+PKD++D CIPP L+A LQV Sbjct: 1124 WLMYFCNHMELPKDILDECIPPGLLAALQV 1153