BLASTX nr result
ID: Papaver30_contig00041293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00041293 (418 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346731.1| PREDICTED: ribonucleoside-diphosphate reduct... 45 7e-06 ref|XP_004236709.1| PREDICTED: ribonucleoside-diphosphate reduct... 45 7e-06 >ref|XP_006346731.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Solanum tuberosum] Length = 808 Score = 45.1 bits (105), Expect(2) = 7e-06 Identities = 23/36 (63%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -1 Query: 376 KEIVYEMIKDMYNHVTDGS*LKAPLISND-FEIIMK 272 K+I E +KDMYNHV++ S LKAPLIS++ +EIIMK Sbjct: 91 KKIFSETVKDMYNHVSERSGLKAPLISDEVYEIIMK 126 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 411 AQIVVSNLHKNTKKLF 364 A+I VSNLHKNTKK+F Sbjct: 79 ARIAVSNLHKNTKKIF 94 >ref|XP_004236709.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Solanum lycopersicum] Length = 808 Score = 45.1 bits (105), Expect(2) = 7e-06 Identities = 23/36 (63%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -1 Query: 376 KEIVYEMIKDMYNHVTDGS*LKAPLISND-FEIIMK 272 K+I E +KDMYNHV++ S LKAPLIS++ +EIIMK Sbjct: 91 KKIFSETVKDMYNHVSERSGLKAPLISDEVYEIIMK 126 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 411 AQIVVSNLHKNTKKLF 364 A+I VSNLHKNTKK+F Sbjct: 79 ARIAVSNLHKNTKKIF 94