BLASTX nr result
ID: Papaver30_contig00040561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00040561 (863 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA04698.1| hypothetical protein SOVF_197280, partial [Spinac... 47 7e-06 >gb|KNA04698.1| hypothetical protein SOVF_197280, partial [Spinacia oleracea] Length = 210 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +3 Query: 240 ETLMVAKALEIVQQEGPALCLHLNVTKTQIYWP 338 +TL+V K LE++ +EGP L LH+NV KT+++WP Sbjct: 178 DTLVVGKVLELILEEGPHLGLHVNVEKTEVFWP 210 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 197 LELQA*YLDDGTLIGDT 247 L LQA YLDDGT++GDT Sbjct: 163 LSLQAWYLDDGTIVGDT 179