BLASTX nr result
ID: Papaver30_contig00040131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00040131 (2314 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014295620.1| PREDICTED: sarcoplasmic reticulum histidine-... 66 2e-07 >ref|XP_014295620.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein-like [Microplitis demolitor] Length = 977 Score = 65.9 bits (159), Expect = 2e-07 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 13/119 (10%) Frame = -1 Query: 745 DHKYINNDLNNDHDCKDHQINQLDHVLDHISELDHGLNYSNQKYHCWNQLYHSLDYSNQY 566 DHKY++ND + DHD DH N H H DH ++ + KY +++ Y + + Sbjct: 160 DHKYVHNDRHYDHD-HDHHHNP-HHYNHHHDRHDHHNDHHDHKY-----VHNDRHYDHDH 212 Query: 565 DFHITQHHFSNHI-----HQQHFSNHRTKYKCRDFKHDHC--------LNHRNQQCHLN 428 D H HH+++H H H+ +H + D HDHC +NH C N Sbjct: 213 DHHHNPHHYNHHHDRHDHHNDHYDDHHDYHHHHDHHHDHCHDHHDDHDVNHNEHDCDYN 271