BLASTX nr result
ID: Papaver30_contig00039187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00039187 (556 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonin... 56 1e-05 gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlise... 56 1e-05 >ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERL1 [Malus domestica] Length = 987 Score = 56.2 bits (134), Expect = 1e-05 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 405 QLLHLWHQCSDVRGNNITGTIPENIGNCTSFEIL 506 QL LW+ DVRGNN+TGTIPENIGNCTSFEIL Sbjct: 219 QLTGLWY--FDVRGNNLTGTIPENIGNCTSFEIL 250 >gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea] Length = 941 Score = 56.2 bits (134), Expect = 1e-05 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 393 SSLRQLLHLWHQCSDVRGNNITGTIPENIGNCTSFEIL 506 S + QL LW+ DVRGNN+TGTIP+NIGNCTSFEIL Sbjct: 176 SDICQLTGLWY--FDVRGNNLTGTIPDNIGNCTSFEIL 211