BLASTX nr result
ID: Papaver30_contig00037662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00037662 (722 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 62 5e-07 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 61.6 bits (148), Expect = 5e-07 Identities = 35/65 (53%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +2 Query: 284 FFSYPGGGNGKQRDIAGYPGIN--TLWVSLDDQIIFT*V*YQ*DTEPPTLLLSMHHVPAL 457 FFSYPGGGNGKQRDIA GI ++ F +Q EP T+LLSMHHVP Sbjct: 4 FFSYPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHHVPTF 63 Query: 458 ISSSN 472 ISS N Sbjct: 64 ISSFN 68