BLASTX nr result
ID: Papaver30_contig00037532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00037532 (505 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC39454.1| (S)-N-methylcoclaurine 3'-hydroxylase [Eschscholz... 67 7e-09 ref|XP_002510306.1| cytochrome P450, putative [Ricinus communis]... 57 7e-06 >gb|AAC39454.1| (S)-N-methylcoclaurine 3'-hydroxylase [Eschscholzia californica] Length = 560 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +2 Query: 326 ARIAGLLALLSFFYYLWITVIRSSRNTKPSSVSPPEVAGAWPILGHLPQLLGS-RPLFKI 502 A I GLLAL+ F YY+ I V S+RN PPE AG+WPI+GHLPQL+GS +PLF++ Sbjct: 11 AGILGLLALICFLYYV-IKVSLSTRNCNQLVKHPPEAAGSWPIVGHLPQLVGSGKPLFRV 69 Query: 503 L 505 L Sbjct: 70 L 70 >ref|XP_002510306.1| cytochrome P450, putative [Ricinus communis] gi|223551007|gb|EEF52493.1| cytochrome P450, putative [Ricinus communis] Length = 528 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = +2 Query: 335 AGLLALLSFFYYLWITVIRSSRNTKPSSVSPPEVAGAWPILGHLPQLLGSRPLFKIL 505 AGL+A+L F +Y + R+T+ + PP+ AG WPILGHLP L G+RP F L Sbjct: 13 AGLIAILFFAFYYVV-----KRSTRTKKLEPPKAAGGWPILGHLPLLSGNRPAFLTL 64