BLASTX nr result
ID: Papaver30_contig00035621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00035621 (1062 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014510444.1| PREDICTED: probable RNA methyltransferase At... 59 9e-06 gb|KOM57819.1| hypothetical protein LR48_Vigan11g085200 [Vigna a... 59 9e-06 ref|XP_007160310.1| hypothetical protein PHAVU_002G310900g [Phas... 59 9e-06 >ref|XP_014510444.1| PREDICTED: probable RNA methyltransferase At5g51130 [Vigna radiata var. radiata] gi|951013991|ref|XP_014510445.1| PREDICTED: probable RNA methyltransferase At5g51130 [Vigna radiata var. radiata] Length = 276 Score = 58.5 bits (140), Expect = 9e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +1 Query: 1 FQEILLDKIGFRTVESCTSSLPCSATGFNRPLFAFRK 111 FQEILLDKIGFRTVE TS L S TGFNRP+ FRK Sbjct: 240 FQEILLDKIGFRTVEDITSGLTLSKTGFNRPILVFRK 276 >gb|KOM57819.1| hypothetical protein LR48_Vigan11g085200 [Vigna angularis] Length = 276 Score = 58.5 bits (140), Expect = 9e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +1 Query: 1 FQEILLDKIGFRTVESCTSSLPCSATGFNRPLFAFRK 111 FQEILLDKIGFRTVE TS L S TGFNRP+ FRK Sbjct: 240 FQEILLDKIGFRTVEDITSGLTLSKTGFNRPILVFRK 276 >ref|XP_007160310.1| hypothetical protein PHAVU_002G310900g [Phaseolus vulgaris] gi|561033725|gb|ESW32304.1| hypothetical protein PHAVU_002G310900g [Phaseolus vulgaris] Length = 291 Score = 58.5 bits (140), Expect = 9e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +1 Query: 1 FQEILLDKIGFRTVESCTSSLPCSATGFNRPLFAFRK 111 FQEILLDKIGFRTVE TS L S TGFNRP+ FRK Sbjct: 255 FQEILLDKIGFRTVEDITSGLTLSKTGFNRPILVFRK 291