BLASTX nr result
ID: Papaver30_contig00035466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00035466 (790 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006449003.1| hypothetical protein CICLE_v10017179mg [Citr... 64 2e-07 gb|KDO75408.1| hypothetical protein CISIN_1g033212mg [Citrus sin... 62 6e-07 gb|KDO38158.1| hypothetical protein CISIN_1g036530mg [Citrus sin... 60 2e-06 ref|XP_006468059.1| PREDICTED: uncharacterized protein LOC102623... 60 2e-06 ref|XP_006427032.1| hypothetical protein CICLE_v10026858mg [Citr... 60 2e-06 gb|KRH58694.1| hypothetical protein GLYMA_05G143000 [Glycine max] 59 3e-06 gb|KHN46056.1| CBL-interacting serine/threonine-protein kinase 3... 59 3e-06 ref|XP_007158744.1| hypothetical protein PHAVU_002G178300g [Phas... 59 3e-06 gb|KOM43343.1| hypothetical protein LR48_Vigan05g094700 [Vigna a... 59 4e-06 ref|XP_010090460.1| hypothetical protein L484_011438 [Morus nota... 59 5e-06 ref|XP_006585090.1| PREDICTED: uncharacterized protein LOC102660... 58 7e-06 ref|XP_006427030.1| hypothetical protein CICLE_v10026747mg [Citr... 58 9e-06 >ref|XP_006449003.1| hypothetical protein CICLE_v10017179mg [Citrus clementina] gi|557551614|gb|ESR62243.1| hypothetical protein CICLE_v10017179mg [Citrus clementina] Length = 125 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -3 Query: 566 RKMAANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASD 426 +K ANSRI+R MEV PP+FV ++R+R +K LDTI+EEEKD +ASD Sbjct: 31 KKKMANSRITRFVMEVAPPQFVSVMRHRTAKMLDTIIEEEKDANASD 77 >gb|KDO75408.1| hypothetical protein CISIN_1g033212mg [Citrus sinensis] Length = 125 Score = 61.6 bits (148), Expect = 6e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 566 RKMAANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASD 426 +K ANSRI+R MEV PP+FV ++R+R +K LDTI EEEKD +ASD Sbjct: 31 KKKMANSRITRFVMEVAPPQFVSVMRHRTAKMLDTISEEEKDANASD 77 >gb|KDO38158.1| hypothetical protein CISIN_1g036530mg [Citrus sinensis] Length = 76 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASD 426 ANSR++R FMEV PP+FV ++R+R K LDTI EEEKD+ SD Sbjct: 2 ANSRMARFFMEVAPPQFVSVMRHRTPKMLDTISEEEKDVSGSD 44 >ref|XP_006468059.1| PREDICTED: uncharacterized protein LOC102623013 [Citrus sinensis] Length = 92 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASD 426 ANSRI+R MEV PP+FV ++R+R +K LDTI EEEKD +ASD Sbjct: 2 ANSRITRFVMEVAPPQFVSVMRHRTAKMLDTISEEEKDANASD 44 >ref|XP_006427032.1| hypothetical protein CICLE_v10026858mg [Citrus clementina] gi|557529022|gb|ESR40272.1| hypothetical protein CICLE_v10026858mg [Citrus clementina] Length = 88 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASD 426 ANSR++R FMEV PP+FV ++R+R K LDTI EEEKD+ SD Sbjct: 2 ANSRMARFFMEVAPPQFVSVMRHRTPKMLDTISEEEKDVSGSD 44 >gb|KRH58694.1| hypothetical protein GLYMA_05G143000 [Glycine max] Length = 89 Score = 59.3 bits (142), Expect = 3e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASDN 423 ANSRI+R FMEV PP++V ++R+R SK LDTI E+E++I SD+ Sbjct: 2 ANSRIARFFMEVAPPQYVTVMRHRTSKMLDTITEDEREISTSDS 45 >gb|KHN46056.1| CBL-interacting serine/threonine-protein kinase 3 [Glycine soja] Length = 169 Score = 59.3 bits (142), Expect = 3e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASDN 423 ANSRI+R FMEV PP++V ++R+R SK LDTI E+E++I SD+ Sbjct: 2 ANSRIARFFMEVAPPQYVTVMRHRTSKMLDTITEDEREISTSDS 45 >ref|XP_007158744.1| hypothetical protein PHAVU_002G178300g [Phaseolus vulgaris] gi|593791432|ref|XP_007158755.1| hypothetical protein PHAVU_002G179400g [Phaseolus vulgaris] gi|561032159|gb|ESW30738.1| hypothetical protein PHAVU_002G178300g [Phaseolus vulgaris] gi|561032170|gb|ESW30749.1| hypothetical protein PHAVU_002G179400g [Phaseolus vulgaris] Length = 82 Score = 59.3 bits (142), Expect = 3e-06 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASDN 423 ANSRI+R FMEV PP++V ++R+R SK LDTI E+EK+I ++D+ Sbjct: 2 ANSRIARFFMEVAPPQYVNVMRHRTSKMLDTITEDEKEISSNDS 45 >gb|KOM43343.1| hypothetical protein LR48_Vigan05g094700 [Vigna angularis] Length = 82 Score = 58.9 bits (141), Expect = 4e-06 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASDN 423 ANSRI+R FMEV PP++V ++R+R SK LDTI E+E++I A+D+ Sbjct: 2 ANSRIARFFMEVAPPQYVTVMRHRTSKMLDTISEDEREISANDS 45 >ref|XP_010090460.1| hypothetical protein L484_011438 [Morus notabilis] gi|587849285|gb|EXB39518.1| hypothetical protein L484_011438 [Morus notabilis] Length = 98 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASDNGN 417 ANSRI+R EV PP+FV ++R+R SK LDTI EEE+D+ A+D+ N Sbjct: 2 ANSRIARFITEVAPPQFVSVMRHRTSKVLDTIKEEERDVCANDSPN 47 >ref|XP_006585090.1| PREDICTED: uncharacterized protein LOC102660764 [Glycine max] gi|734350490|gb|KHN12437.1| hypothetical protein glysoja_018567 [Glycine soja] gi|947093999|gb|KRH42584.1| hypothetical protein GLYMA_08G099000 [Glycine max] Length = 90 Score = 58.2 bits (139), Expect = 7e-06 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASDN 423 ANSRI+R FMEV PP++V ++R+R SK LDTI E+E++I +D+ Sbjct: 2 ANSRIARFFMEVAPPQYVTVMRHRTSKMLDTITEDEREISTNDS 45 >ref|XP_006427030.1| hypothetical protein CICLE_v10026747mg [Citrus clementina] gi|557529020|gb|ESR40270.1| hypothetical protein CICLE_v10026747mg [Citrus clementina] gi|641832154|gb|KDO51194.1| hypothetical protein CISIN_1g032717mg [Citrus sinensis] Length = 135 Score = 57.8 bits (138), Expect = 9e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 554 ANSRISRLFMEVVPPKFVPIIRYRASKPLDTIVEEEKDIHASD 426 ANSRI++ MEV PP+FV ++R+R +K LDTI EEEKD+ SD Sbjct: 46 ANSRIAKFVMEVAPPQFVSVMRHRTAKMLDTISEEEKDVSGSD 88