BLASTX nr result
ID: Papaver30_contig00035133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00035133 (864 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW81019.1| hypothetical protein EUGRSUZ_C023932, partial [Eu... 60 2e-06 gb|KNA20574.1| hypothetical protein SOVF_051150 [Spinacia oleracea] 59 5e-06 ref|XP_010691726.1| PREDICTED: phenylalanine--tRNA ligase, chlor... 59 5e-06 ref|XP_009785442.1| PREDICTED: phenylalanine--tRNA ligase, chlor... 59 5e-06 ref|XP_008225884.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanin... 59 5e-06 ref|XP_007211725.1| hypothetical protein PRUPE_ppa006022mg [Prun... 59 5e-06 emb|CAN69908.1| hypothetical protein VITISV_012484 [Vitis vinifera] 59 5e-06 ref|XP_013648363.1| PREDICTED: phenylalanine--tRNA ligase, chlor... 58 8e-06 ref|XP_013591870.1| PREDICTED: phenylalanine--tRNA ligase, chlor... 58 8e-06 ref|XP_010048669.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanin... 58 8e-06 ref|XP_009104117.1| PREDICTED: phenylalanine--tRNA ligase, chlor... 58 8e-06 ref|XP_009104116.1| PREDICTED: phenylalanine--tRNA ligase, chlor... 58 8e-06 emb|CDX67722.1| BnaA07g17620D [Brassica napus] 58 8e-06 emb|CDX98270.1| BnaC06g16310D [Brassica napus] 58 8e-06 gb|KFK35039.1| hypothetical protein AALP_AA5G226200 [Arabis alpina] 58 8e-06 ref|XP_010048601.1| PREDICTED: phenylalanine--tRNA ligase, chlor... 58 8e-06 ref|XP_006402805.1| hypothetical protein EUTSA_v10005992mg [Eutr... 58 8e-06 >gb|KCW81019.1| hypothetical protein EUGRSUZ_C023932, partial [Eucalyptus grandis] Length = 367 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 146 LALLNLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 + L L GAVEMRW+DTYFPFT+PSFELEI+FQ Sbjct: 171 ICTLELLGAVEMRWIDTYFPFTDPSFELEIYFQ 203 >gb|KNA20574.1| hypothetical protein SOVF_051150 [Spinacia oleracea] Length = 452 Score = 58.9 bits (141), Expect = 5e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFT PSFELEIFFQ Sbjct: 260 HLFGAVEMRWVDTYFPFTSPSFELEIFFQ 288 >ref|XP_010691726.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris] gi|731360283|ref|XP_010691727.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris] gi|731360287|ref|XP_010691728.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris] gi|870848890|gb|KMT01179.1| hypothetical protein BVRB_9g224310 [Beta vulgaris subsp. vulgaris] Length = 450 Score = 58.9 bits (141), Expect = 5e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFT PSFELEIFFQ Sbjct: 258 HLFGAVEMRWVDTYFPFTSPSFELEIFFQ 286 >ref|XP_009785442.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Nicotiana sylvestris] Length = 276 Score = 58.9 bits (141), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQVF 250 +L G VEMRWVDTYFPFT PSFELEI+FQV+ Sbjct: 232 HLFGGVEMRWVDTYFPFTNPSFELEIYFQVY 262 >ref|XP_008225884.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Prunus mume] Length = 433 Score = 58.9 bits (141), Expect = 5e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFT PSFELEIFFQ Sbjct: 241 HLFGAVEMRWVDTYFPFTNPSFELEIFFQ 269 >ref|XP_007211725.1| hypothetical protein PRUPE_ppa006022mg [Prunus persica] gi|462407590|gb|EMJ12924.1| hypothetical protein PRUPE_ppa006022mg [Prunus persica] Length = 432 Score = 58.9 bits (141), Expect = 5e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFT PSFELEIFFQ Sbjct: 240 HLFGAVEMRWVDTYFPFTNPSFELEIFFQ 268 >emb|CAN69908.1| hypothetical protein VITISV_012484 [Vitis vinifera] Length = 304 Score = 58.9 bits (141), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQVF 250 +L G VEMRW+DTYFPFT PSFELEI+FQVF Sbjct: 250 HLFGNVEMRWIDTYFPFTNPSFELEIYFQVF 280 >ref|XP_013648363.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Brassica napus] Length = 430 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 238 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 266 >ref|XP_013591870.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial [Brassica oleracea var. oleracea] Length = 430 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 238 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 266 >ref|XP_010048669.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like [Eucalyptus grandis] Length = 440 Score = 58.2 bits (139), Expect = 8e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRW+DTYFPFT+PSFELEI+FQ Sbjct: 248 HLFGAVEMRWIDTYFPFTDPSFELEIYFQ 276 >ref|XP_009104117.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial isoform X2 [Brassica rapa] Length = 426 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 234 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 262 >ref|XP_009104116.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Brassica rapa] Length = 430 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 238 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 266 >emb|CDX67722.1| BnaA07g17620D [Brassica napus] Length = 430 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 238 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 266 >emb|CDX98270.1| BnaC06g16310D [Brassica napus] Length = 430 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 238 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 266 >gb|KFK35039.1| hypothetical protein AALP_AA5G226200 [Arabis alpina] Length = 432 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 239 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 267 >ref|XP_010048601.1| PREDICTED: phenylalanine--tRNA ligase, chloroplastic/mitochondrial-like [Eucalyptus grandis] gi|629116235|gb|KCW80910.1| hypothetical protein EUGRSUZ_C02274 [Eucalyptus grandis] Length = 439 Score = 58.2 bits (139), Expect = 8e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRW+DTYFPFT+PSFELEI+FQ Sbjct: 247 HLFGAVEMRWIDTYFPFTDPSFELEIYFQ 275 >ref|XP_006402805.1| hypothetical protein EUTSA_v10005992mg [Eutrema salsugineum] gi|557103904|gb|ESQ44258.1| hypothetical protein EUTSA_v10005992mg [Eutrema salsugineum] Length = 430 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 158 NLTGAVEMRWVDTYFPFTEPSFELEIFFQ 244 +L GAVEMRWVDTYFPFTEPSFELEI+F+ Sbjct: 238 HLFGAVEMRWVDTYFPFTEPSFELEIYFK 266