BLASTX nr result
ID: Papaver30_contig00034076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00034076 (1233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007149542.1| hypothetical protein PHAVU_005G079000g [Phas... 60 3e-06 >ref|XP_007149542.1| hypothetical protein PHAVU_005G079000g [Phaseolus vulgaris] gi|561022806|gb|ESW21536.1| hypothetical protein PHAVU_005G079000g [Phaseolus vulgaris] Length = 83 Score = 60.5 bits (145), Expect = 3e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = +1 Query: 1 EVEALTEIMITLGKQGWDFANPCNATEGIICTCTFSGNTACHVTEM 138 EV+AL +I LGK WDF++PCN ++C C ++G T CHVT M Sbjct: 38 EVKALEDIAKRLGKNDWDFSDPCNLASEVVCNCDYNGGTVCHVTNM 83