BLASTX nr result
ID: Papaver30_contig00032197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00032197 (488 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009599695.1| PREDICTED: SNARE-interacting protein KEULE [... 59 1e-06 ref|XP_011093220.1| PREDICTED: protein transport Sec1a-like isof... 58 3e-06 ref|XP_011093219.1| PREDICTED: protein transport Sec1a-like isof... 58 3e-06 ref|XP_009764743.1| PREDICTED: SNARE-interacting protein KEULE i... 57 4e-06 ref|XP_009764741.1| PREDICTED: SNARE-interacting protein KEULE i... 57 4e-06 ref|XP_006363728.1| PREDICTED: SNARE-interacting protein KEULE-l... 57 7e-06 ref|XP_004245704.1| PREDICTED: SNARE-interacting protein KEULE [... 57 7e-06 emb|CDO97685.1| unnamed protein product [Coffea canephora] 56 9e-06 >ref|XP_009599695.1| PREDICTED: SNARE-interacting protein KEULE [Nicotiana tomentosiformis] Length = 666 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 AVWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 AVWN LT YK +L +FPQTETCELLILDRSVD I+ Sbjct: 232 AVWNSLTKYKSTLPHFPQTETCELLILDRSVDQIA 266 >ref|XP_011093220.1| PREDICTED: protein transport Sec1a-like isoform X2 [Sesamum indicum] Length = 568 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -3 Query: 132 KLTERSSSIAVWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 +L + AVW+Q+T+YK S+ FPQTETCELLI+DRSVD I+ Sbjct: 123 ELVPTKLAAAVWDQITTYKSSIHNFPQTETCELLIVDRSVDQIA 166 >ref|XP_011093219.1| PREDICTED: protein transport Sec1a-like isoform X1 [Sesamum indicum] Length = 668 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -3 Query: 132 KLTERSSSIAVWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 +L + AVW+Q+T+YK S+ FPQTETCELLI+DRSVD I+ Sbjct: 223 ELVPTKLAAAVWDQITTYKSSIHNFPQTETCELLIVDRSVDQIA 266 >ref|XP_009764743.1| PREDICTED: SNARE-interacting protein KEULE isoform X3 [Nicotiana sylvestris] Length = 581 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 105 AVWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 AVWN L YK +L +FPQTETCELLILDRSVD I+ Sbjct: 147 AVWNSLAKYKSTLPHFPQTETCELLILDRSVDQIA 181 >ref|XP_009764741.1| PREDICTED: SNARE-interacting protein KEULE isoform X1 [Nicotiana sylvestris] gi|698537161|ref|XP_009764742.1| PREDICTED: SNARE-interacting protein KEULE isoform X2 [Nicotiana sylvestris] Length = 691 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 105 AVWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 AVWN L YK +L +FPQTETCELLILDRSVD I+ Sbjct: 257 AVWNSLAKYKSTLPHFPQTETCELLILDRSVDQIA 291 >ref|XP_006363728.1| PREDICTED: SNARE-interacting protein KEULE-like [Solanum tuberosum] Length = 666 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 102 VWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 VWN LT YK +L +FPQTETCELLI+DRSVD I+ Sbjct: 233 VWNSLTKYKSTLPHFPQTETCELLIVDRSVDQIA 266 >ref|XP_004245704.1| PREDICTED: SNARE-interacting protein KEULE [Solanum lycopersicum] Length = 666 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 102 VWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 VWN LT YK +L +FPQTETCELLI+DRSVD I+ Sbjct: 233 VWNSLTKYKSTLPHFPQTETCELLIVDRSVDQIA 266 >emb|CDO97685.1| unnamed protein product [Coffea canephora] Length = 685 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 105 AVWNQLTSYKDSLRYFPQTETCELLILDRSVDLIS 1 A+WN +T+YK S+ FPQTETCELLILDRS+D I+ Sbjct: 252 AIWNSITTYKASIPNFPQTETCELLILDRSIDQIA 286