BLASTX nr result
ID: Papaver30_contig00031832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00031832 (1184 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008355340.1| PREDICTED: syntaxin-61-like, partial [Malus ... 74 3e-10 ref|XP_008349937.1| PREDICTED: syntaxin-61-like, partial [Malus ... 72 7e-10 gb|AAF16768.1|AC010155_21 F3M18.7 [Arabidopsis thaliana] 68 2e-08 ref|XP_009360991.1| PREDICTED: syntaxin-61-like isoform X2 [Pyru... 67 3e-08 ref|XP_008226891.1| PREDICTED: syntaxin-61 [Prunus mume] gi|6452... 67 4e-08 ref|XP_007211922.1| hypothetical protein PRUPE_ppa010587mg [Prun... 67 4e-08 ref|XP_009338701.1| PREDICTED: syntaxin-61-like isoform X2 [Pyru... 66 7e-08 ref|XP_008385968.1| PREDICTED: syntaxin-61 [Malus domestica] 66 7e-08 ref|XP_012090854.1| PREDICTED: syntaxin-61 [Jatropha curcas] gi|... 66 7e-08 ref|XP_009404898.1| PREDICTED: syntaxin-61-like isoform X2 [Musa... 65 9e-08 ref|XP_009404897.1| PREDICTED: syntaxin-61-like isoform X1 [Musa... 65 9e-08 ref|XP_006475038.1| PREDICTED: syntaxin-61-like [Citrus sinensis... 65 9e-08 ref|XP_006452410.1| hypothetical protein CICLE_v10009295mg [Citr... 65 9e-08 ref|XP_007025513.1| Syntaxin of plants 61 [Theobroma cacao] gi|5... 65 9e-08 ref|XP_010938949.1| PREDICTED: syntaxin-61-like [Elaeis guineensis] 65 1e-07 ref|XP_009360989.1| PREDICTED: syntaxin-61-like isoform X1 [Pyru... 65 1e-07 ref|XP_006595734.1| PREDICTED: syntaxin-61-like isoform X2 [Glyc... 65 1e-07 ref|XP_011623146.1| PREDICTED: syntaxin-61 [Amborella trichopoda] 65 1e-07 ref|XP_011027754.1| PREDICTED: syntaxin-61 [Populus euphratica] 65 1e-07 ref|XP_010274513.1| PREDICTED: syntaxin-61-like [Nelumbo nucifera] 65 1e-07 >ref|XP_008355340.1| PREDICTED: syntaxin-61-like, partial [Malus domestica] Length = 211 Score = 73.6 bits (179), Expect = 3e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 317 MYLLNI*FLDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 + LL FLD+KVDELDKAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 12 LQLLKGCFLDRKVDELDKAISVAARDPTWYGIDEVELEKRRRW 54 >ref|XP_008349937.1| PREDICTED: syntaxin-61-like, partial [Malus domestica] Length = 198 Score = 72.4 bits (176), Expect = 7e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 311 LLNI*FLDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 LL FLD+KVDEL+KAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 1 LLKACFLDRKVDELNKAISVAARDPTWYGIDEVELEKRRRW 41 >gb|AAF16768.1|AC010155_21 F3M18.7 [Arabidopsis thaliana] Length = 241 Score = 67.8 bits (164), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 296 FLDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 F D+KVDEL+KAI VA++DPSWYGIDE ELEKRRRW Sbjct: 74 FTDRKVDELEKAITVAAKDPSWYGIDEAELEKRRRW 109 >ref|XP_009360991.1| PREDICTED: syntaxin-61-like isoform X2 [Pyrus x bretschneideri] Length = 210 Score = 67.0 bits (162), Expect = 3e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 287 KKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 +KVDELDKAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 21 RKVDELDKAISVAARDPTWYGIDEVELEKRRRW 53 >ref|XP_008226891.1| PREDICTED: syntaxin-61 [Prunus mume] gi|645241046|ref|XP_008226892.1| PREDICTED: syntaxin-61 [Prunus mume] Length = 244 Score = 66.6 bits (161), Expect = 4e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 +D +VDELDKAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 53 IDWQVDELDKAISVAARDPTWYGIDEVELEKRRRW 87 >ref|XP_007211922.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica] gi|595865280|ref|XP_007211923.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica] gi|462407787|gb|EMJ13121.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica] gi|462407788|gb|EMJ13122.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica] Length = 244 Score = 66.6 bits (161), Expect = 4e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 +D +VDELDKAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 53 IDWQVDELDKAISVAARDPTWYGIDEVELEKRRRW 87 >ref|XP_009338701.1| PREDICTED: syntaxin-61-like isoform X2 [Pyrus x bretschneideri] Length = 210 Score = 65.9 bits (159), Expect = 7e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 320 SMYLLNI*FLDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 S LL + +KVDEL+KAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 10 SCLLLVVALNGRKVDELNKAISVAARDPTWYGIDEVELEKRRRW 53 >ref|XP_008385968.1| PREDICTED: syntaxin-61 [Malus domestica] Length = 182 Score = 65.9 bits (159), Expect = 7e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 320 SMYLLNI*FLDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 S LL + +KVDEL+KAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 10 SCLLLVVALNGRKVDELNKAISVAARDPTWYGIDEVELEKRRRW 53 >ref|XP_012090854.1| PREDICTED: syntaxin-61 [Jatropha curcas] gi|643705361|gb|KDP21907.1| hypothetical protein JCGZ_03045 [Jatropha curcas] Length = 246 Score = 65.9 bits (159), Expect = 7e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAI VA+RDPSWYGIDEVELEKRRRW Sbjct: 53 IEWQVDELDKAIGVAARDPSWYGIDEVELEKRRRW 87 >ref|XP_009404898.1| PREDICTED: syntaxin-61-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 239 Score = 65.5 bits (158), Expect = 9e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAIAVA+RDP+WYG+DEVELEKRRRW Sbjct: 53 IEWQVDELDKAIAVAARDPAWYGLDEVELEKRRRW 87 >ref|XP_009404897.1| PREDICTED: syntaxin-61-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 249 Score = 65.5 bits (158), Expect = 9e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAIAVA+RDP+WYG+DEVELEKRRRW Sbjct: 53 IEWQVDELDKAIAVAARDPAWYGLDEVELEKRRRW 87 >ref|XP_006475038.1| PREDICTED: syntaxin-61-like [Citrus sinensis] gi|641843163|gb|KDO62064.1| hypothetical protein CISIN_1g047293mg [Citrus sinensis] Length = 246 Score = 65.5 bits (158), Expect = 9e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAI VASRDPSWYGID++ELEKRRRW Sbjct: 53 IEWQVDELDKAIGVASRDPSWYGIDDIELEKRRRW 87 >ref|XP_006452410.1| hypothetical protein CICLE_v10009295mg [Citrus clementina] gi|557555636|gb|ESR65650.1| hypothetical protein CICLE_v10009295mg [Citrus clementina] Length = 246 Score = 65.5 bits (158), Expect = 9e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAI VASRDPSWYGID++ELEKRRRW Sbjct: 53 IEWQVDELDKAIGVASRDPSWYGIDDIELEKRRRW 87 >ref|XP_007025513.1| Syntaxin of plants 61 [Theobroma cacao] gi|508780879|gb|EOY28135.1| Syntaxin of plants 61 [Theobroma cacao] Length = 243 Score = 65.5 bits (158), Expect = 9e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 311 LLNI*FLDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 L N ++ +VDELDK I+VA+RDPSWYGIDEVELEKRRRW Sbjct: 47 LANCESIEWQVDELDKTISVAARDPSWYGIDEVELEKRRRW 87 >ref|XP_010938949.1| PREDICTED: syntaxin-61-like [Elaeis guineensis] Length = 249 Score = 65.1 bits (157), Expect = 1e-07 Identities = 31/55 (56%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 329 IIPSMYLLNI*FLDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW-NCSHSGI 168 ++ L N + +VDELDKAIAVA+RDP+WYG++EVELEKRRRW N +H + Sbjct: 41 LLTKQLLANCESIKWQVDELDKAIAVAARDPAWYGLNEVELEKRRRWTNIAHKQV 95 >ref|XP_009360989.1| PREDICTED: syntaxin-61-like isoform X1 [Pyrus x bretschneideri] gi|694363430|ref|XP_009360990.1| PREDICTED: syntaxin-61-like isoform X1 [Pyrus x bretschneideri] Length = 244 Score = 65.1 bits (157), Expect = 1e-07 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAI+VA+RDP+WYGIDEVELEKRRRW Sbjct: 53 IEWQVDELDKAISVAARDPTWYGIDEVELEKRRRW 87 >ref|XP_006595734.1| PREDICTED: syntaxin-61-like isoform X2 [Glycine max] gi|947065251|gb|KRH14394.1| hypothetical protein GLYMA_14G023200 [Glycine max] Length = 210 Score = 65.1 bits (157), Expect = 1e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 287 KKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 +KVDELDKAI+VASRDPSWYGIDEVE+E RR+W Sbjct: 22 RKVDELDKAISVASRDPSWYGIDEVEVENRRKW 54 >ref|XP_011623146.1| PREDICTED: syntaxin-61 [Amborella trichopoda] Length = 291 Score = 64.7 bits (156), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 281 VDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 VDELDKAIAVA+RDPSWYGIDE ELEKRRRW Sbjct: 103 VDELDKAIAVAARDPSWYGIDEFELEKRRRW 133 >ref|XP_011027754.1| PREDICTED: syntaxin-61 [Populus euphratica] Length = 246 Score = 64.7 bits (156), Expect = 1e-07 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAI+VA+RDPSWYGIDE ELEKRRRW Sbjct: 53 IEWQVDELDKAISVAARDPSWYGIDEAELEKRRRW 87 >ref|XP_010274513.1| PREDICTED: syntaxin-61-like [Nelumbo nucifera] Length = 246 Score = 64.7 bits (156), Expect = 1e-07 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = -1 Query: 293 LDKKVDELDKAIAVASRDPSWYGIDEVELEKRRRW 189 ++ +VDELDKAIAVA+RDP+WYGIDE+EL+KRRRW Sbjct: 53 IEWQVDELDKAIAVAARDPAWYGIDEIELDKRRRW 87