BLASTX nr result
ID: Papaver30_contig00031759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00031759 (560 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223561.1| hypothetical protein PRUPE_ppa012232mg [Prun... 57 8e-06 >ref|XP_007223561.1| hypothetical protein PRUPE_ppa012232mg [Prunus persica] gi|462420497|gb|EMJ24760.1| hypothetical protein PRUPE_ppa012232mg [Prunus persica] Length = 178 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 368 GHHRISWRYV*GNFCLLYHNQKLIDDRFVLQDFG 267 GH ISW++V GNFCL YHN KL+DD LQDFG Sbjct: 130 GHRHISWKHVWGNFCLSYHNDKLLDDNAALQDFG 163