BLASTX nr result
ID: Papaver30_contig00029915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00029915 (664 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDR69847.1| hypothetical protein GALMADRAFT_214918 [Galerina ... 61 7e-07 gb|KIL54493.1| hypothetical protein M378DRAFT_1055673 [Amanita m... 59 3e-06 >gb|KDR69847.1| hypothetical protein GALMADRAFT_214918 [Galerina marginata CBS 339.88] Length = 681 Score = 60.8 bits (146), Expect = 7e-07 Identities = 27/59 (45%), Positives = 39/59 (66%) Frame = -2 Query: 657 ALHWMTEKLTSTSLRILKFGTCCLQNPVRQPLLREPPRDLGELYEGDDARSNLSQTHLK 481 ALHWM E+L+S++ KFG CCLQ ++ P L PP +L L++G D RS L + H++ Sbjct: 118 ALHWMAERLSSSTHNNNKFGKCCLQGKIQLPPLHNPPPELDLLFKGRDDRSKLFRDHIR 176 >gb|KIL54493.1| hypothetical protein M378DRAFT_1055673 [Amanita muscaria Koide BX008] Length = 1391 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = -2 Query: 657 ALHWMTEKLTSTSLRILKFGTCCLQNPVRQPLLREPPRDLGELYEGDDARSNLSQTHL 484 ALHW E+LT ++ KFGTCCL V P L+EPPR+L ELY G +S H+ Sbjct: 10 ALHWRKERLTRSTNANPKFGTCCLDGKVSIPSLQEPPRELWELYNGTSLQSTHFLDHI 67