BLASTX nr result
ID: Papaver30_contig00029106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00029106 (874 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH26302.1| hypothetical protein GLYMA_12G1662002, partial [G... 62 7e-07 dbj|BAT16512.1| Os12g0244100, partial [Oryza sativa Japonica Group] 62 7e-07 gb|KMZ58558.1| Stromal 70 kDa heat shock-related protein, chloro... 62 7e-07 ref|XP_010095881.1| Stromal 70 kDa heat shock-related protein [M... 62 7e-07 ref|XP_010087927.1| Stromal 70 kDa heat shock-related protein [M... 62 7e-07 ref|XP_012454420.1| PREDICTED: stromal 70 kDa heat shock-related... 62 7e-07 gb|KJB38009.1| hypothetical protein B456_006G232400 [Gossypium r... 62 7e-07 gb|KJB38008.1| hypothetical protein B456_006G232400 [Gossypium r... 62 7e-07 ref|XP_012487071.1| PREDICTED: heat shock 70 kDa protein 6, chlo... 62 7e-07 gb|KJB27776.1| hypothetical protein B456_005G009100 [Gossypium r... 62 7e-07 ref|XP_012481432.1| PREDICTED: heat shock 70 kDa protein 6, chlo... 62 7e-07 ref|XP_010932308.1| PREDICTED: stromal 70 kDa heat shock-related... 62 7e-07 gb|KHN39675.1| Stromal 70 kDa heat shock-related protein, chloro... 62 7e-07 gb|KHG03789.1| Heat shock 70 kDa 6, chloroplastic -like protein ... 62 7e-07 gb|KHG00021.1| Heat shock 70 kDa 7, chloroplastic -like protein ... 62 7e-07 ref|XP_010442469.1| PREDICTED: heat shock 70 kDa protein 7, chlo... 62 7e-07 ref|XP_010238578.1| PREDICTED: stromal 70 kDa heat shock-related... 62 7e-07 ref|XP_010242659.1| PREDICTED: heat shock 70 kDa protein 6, chlo... 62 7e-07 ref|XP_010242658.1| PREDICTED: stromal 70 kDa heat shock-related... 62 7e-07 ref|XP_010266362.1| PREDICTED: stromal 70 kDa heat shock-related... 62 7e-07 >gb|KRH26302.1| hypothetical protein GLYMA_12G1662002, partial [Glycine max] Length = 276 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 201 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 234 >dbj|BAT16512.1| Os12g0244100, partial [Oryza sativa Japonica Group] Length = 630 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 145 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 178 >gb|KMZ58558.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Zostera marina] Length = 706 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 217 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 250 >ref|XP_010095881.1| Stromal 70 kDa heat shock-related protein [Morus notabilis] gi|587873236|gb|EXB62431.1| Stromal 70 kDa heat shock-related protein [Morus notabilis] Length = 707 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 219 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 252 >ref|XP_010087927.1| Stromal 70 kDa heat shock-related protein [Morus notabilis] gi|587840123|gb|EXB30762.1| Stromal 70 kDa heat shock-related protein [Morus notabilis] Length = 707 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 219 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 252 >ref|XP_012454420.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic [Gossypium raimondii] gi|763804681|gb|KJB71619.1| hypothetical protein B456_011G134000 [Gossypium raimondii] gi|763804682|gb|KJB71620.1| hypothetical protein B456_011G134000 [Gossypium raimondii] Length = 706 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 221 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 254 >gb|KJB38009.1| hypothetical protein B456_006G232400 [Gossypium raimondii] Length = 452 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 222 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 255 >gb|KJB38008.1| hypothetical protein B456_006G232400 [Gossypium raimondii] Length = 589 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 222 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 255 >ref|XP_012487071.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Gossypium raimondii] gi|763770792|gb|KJB38007.1| hypothetical protein B456_006G232400 [Gossypium raimondii] Length = 706 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 222 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 255 >gb|KJB27776.1| hypothetical protein B456_005G009100 [Gossypium raimondii] Length = 576 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 219 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 252 >ref|XP_012481432.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic [Gossypium raimondii] gi|763760521|gb|KJB27775.1| hypothetical protein B456_005G009100 [Gossypium raimondii] Length = 704 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 219 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 252 >ref|XP_010932308.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like [Elaeis guineensis] Length = 706 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 222 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 255 >gb|KHN39675.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Glycine soja] Length = 611 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 126 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 159 >gb|KHG03789.1| Heat shock 70 kDa 6, chloroplastic -like protein [Gossypium arboreum] Length = 696 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 222 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 255 >gb|KHG00021.1| Heat shock 70 kDa 7, chloroplastic -like protein [Gossypium arboreum] Length = 706 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 221 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 254 >ref|XP_010442469.1| PREDICTED: heat shock 70 kDa protein 7, chloroplastic-like [Camelina sativa] Length = 717 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 229 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 262 >ref|XP_010238578.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like [Brachypodium distachyon] gi|944056100|gb|KQJ91738.1| hypothetical protein BRADI_4g39470 [Brachypodium distachyon] Length = 688 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 202 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 235 >ref|XP_010242659.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Nelumbo nucifera] Length = 526 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 226 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 259 >ref|XP_010242658.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like [Nelumbo nucifera] Length = 400 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 226 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 259 >ref|XP_010266362.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic [Nelumbo nucifera] Length = 713 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 872 TKDAGRIAGLKVLRSMNEPTAASLAYGFEKKNYE 771 TKDAGRIAGL+VLR +NEPTAASLAYGFEKKN E Sbjct: 227 TKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNE 260