BLASTX nr result
ID: Papaver30_contig00028100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00028100 (459 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010936469.1| PREDICTED: replication protein A 70 kDa DNA-... 53 1e-05 ref|XP_010936470.1| PREDICTED: replication protein A 70 kDa DNA-... 53 1e-05 >ref|XP_010936469.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit B-like isoform X1 [Elaeis guineensis] Length = 627 Score = 52.8 bits (125), Expect(2) = 1e-05 Identities = 27/53 (50%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -1 Query: 336 KIVAPVLEYEIVTDPKVQDTGIIVKPKKD-AGIILRPKQGIAA*SAAQIVHEQ 181 ++V+P LE EI +D + ++GI++KPKKD + I+L+PKQ + SAAQI+HEQ Sbjct: 112 EVVSPSLEMEIKSDVEKVESGILLKPKKDESRILLKPKQEAVSKSAAQIMHEQ 164 Score = 23.1 bits (48), Expect(2) = 1e-05 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 445 AMLPSYMSSDINLGESQ 395 AMLPS+ SS+I+ G Q Sbjct: 67 AMLPSHFSSEIHSGNLQ 83 >ref|XP_010936470.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit B-like isoform X2 [Elaeis guineensis] Length = 618 Score = 52.8 bits (125), Expect(2) = 1e-05 Identities = 27/53 (50%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -1 Query: 336 KIVAPVLEYEIVTDPKVQDTGIIVKPKKD-AGIILRPKQGIAA*SAAQIVHEQ 181 ++V+P LE EI +D + ++GI++KPKKD + I+L+PKQ + SAAQI+HEQ Sbjct: 103 EVVSPSLEMEIKSDVEKVESGILLKPKKDESRILLKPKQEAVSKSAAQIMHEQ 155 Score = 23.1 bits (48), Expect(2) = 1e-05 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 445 AMLPSYMSSDINLGESQ 395 AMLPS+ SS+I+ G Q Sbjct: 58 AMLPSHFSSEIHSGNLQ 74