BLASTX nr result
ID: Papaver30_contig00026170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00026170 (561 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA18011.1| hypothetical protein SOVF_074180 [Spinacia oleracea] 60 9e-07 ref|XP_010675602.1| PREDICTED: uncharacterized protein LOC104891... 58 3e-06 ref|XP_002284635.1| PREDICTED: uncharacterized protein LOC100264... 57 8e-06 >gb|KNA18011.1| hypothetical protein SOVF_074180 [Spinacia oleracea] Length = 299 Score = 59.7 bits (143), Expect = 9e-07 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 10/49 (20%) Frame = -1 Query: 561 RVTAFMVSSHIVSFRKP---NQQQL-------LSFSGEFRVDWRCHGLC 445 RVTA+MVSSHIVSFRKP QQQL S++GE R+DWRCH LC Sbjct: 251 RVTAYMVSSHIVSFRKPCYQQQQQLQHMVGPVYSYAGEVRLDWRCHNLC 299 >ref|XP_010675602.1| PREDICTED: uncharacterized protein LOC104891592 [Beta vulgaris subsp. vulgaris] gi|870861747|gb|KMT13017.1| hypothetical protein BVRB_4g087320 [Beta vulgaris subsp. vulgaris] Length = 309 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 11/50 (22%) Frame = -1 Query: 561 RVTAFMVSSHIVSFRKP------NQQQLL-----SFSGEFRVDWRCHGLC 445 RVTA+MVSSHIVSFRKP QQQ + S++GE R+DWRCH LC Sbjct: 260 RVTAYMVSSHIVSFRKPCYQLLQAQQQYMVGPVYSYAGEVRLDWRCHNLC 309 >ref|XP_002284635.1| PREDICTED: uncharacterized protein LOC100264154 [Vitis vinifera] Length = 291 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -1 Query: 561 RVTAFMVSSHIVSFRKPNQQQLLSFSGEFRVDWRCHGLC 445 RVTAFMVSSHIVSFRKPN LL GE R+DWRC +C Sbjct: 255 RVTAFMVSSHIVSFRKPN--HLLLGPGEVRLDWRCTNIC 291