BLASTX nr result
ID: Papaver30_contig00024501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00024501 (459 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012475020.1| PREDICTED: uncharacterized protein LOC105791... 56 9e-06 gb|KJB24462.1| hypothetical protein B456_004G146600 [Gossypium r... 56 9e-06 ref|XP_012475019.1| PREDICTED: uncharacterized protein LOC105791... 56 9e-06 gb|KHG18237.1| Chaperone DnaK [Gossypium arboreum] 56 9e-06 ref|XP_002515214.1| conserved hypothetical protein [Ricinus comm... 56 9e-06 >ref|XP_012475020.1| PREDICTED: uncharacterized protein LOC105791485 isoform X2 [Gossypium raimondii] gi|763757132|gb|KJB24463.1| hypothetical protein B456_004G146600 [Gossypium raimondii] Length = 313 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 459 ALVHIPCYSFYALVVKAKNSAFTKLFPNAFVRS 361 ALVHIPCY YAL+VKAKNS +LFP+AFVRS Sbjct: 280 ALVHIPCYGMYALIVKAKNSILPRLFPHAFVRS 312 >gb|KJB24462.1| hypothetical protein B456_004G146600 [Gossypium raimondii] Length = 413 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 459 ALVHIPCYSFYALVVKAKNSAFTKLFPNAFVRS 361 ALVHIPCY YAL+VKAKNS +LFP+AFVRS Sbjct: 380 ALVHIPCYGMYALIVKAKNSILPRLFPHAFVRS 412 >ref|XP_012475019.1| PREDICTED: uncharacterized protein LOC105791485 isoform X1 [Gossypium raimondii] gi|763757129|gb|KJB24460.1| hypothetical protein B456_004G146600 [Gossypium raimondii] Length = 333 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 459 ALVHIPCYSFYALVVKAKNSAFTKLFPNAFVRS 361 ALVHIPCY YAL+VKAKNS +LFP+AFVRS Sbjct: 300 ALVHIPCYGMYALIVKAKNSILPRLFPHAFVRS 332 >gb|KHG18237.1| Chaperone DnaK [Gossypium arboreum] Length = 414 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 459 ALVHIPCYSFYALVVKAKNSAFTKLFPNAFVRS 361 ALVHIPCY YAL+VKAKNS +LFP+AFVRS Sbjct: 381 ALVHIPCYGMYALIVKAKNSILPRLFPHAFVRS 413 >ref|XP_002515214.1| conserved hypothetical protein [Ricinus communis] gi|223545694|gb|EEF47198.1| conserved hypothetical protein [Ricinus communis] Length = 338 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 459 ALVHIPCYSFYALVVKAKNSAFTKLFPNAFVRS 361 ALVHIPCY Y+L+VKAKNS F K FP+AFVRS Sbjct: 305 ALVHIPCYGIYSLIVKAKNSIFPKWFPHAFVRS 337