BLASTX nr result
ID: Papaver30_contig00023379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00023379 (740 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025730.1| Pentatricopeptide repeat-containing protein,... 105 4e-20 ref|XP_007025729.1| Pentatricopeptide repeat-containing protein,... 105 4e-20 ref|XP_008218493.1| PREDICTED: pentatricopeptide repeat-containi... 104 5e-20 ref|XP_007205009.1| hypothetical protein PRUPE_ppa003637mg [Prun... 104 5e-20 ref|XP_010242491.1| PREDICTED: pentatricopeptide repeat-containi... 102 3e-19 ref|XP_013461142.1| PPR containing plant protein [Medicago trunc... 102 3e-19 emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] 102 3e-19 gb|KOM46765.1| hypothetical protein LR48_Vigan07g046900 [Vigna a... 100 8e-19 ref|XP_006351118.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-18 ref|XP_010088586.1| hypothetical protein L484_016979 [Morus nota... 100 2e-18 ref|XP_010917712.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-18 gb|KHN32628.1| Pentatricopeptide repeat-containing protein, mito... 99 2e-18 ref|XP_009408333.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-18 ref|XP_008808558.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 99 2e-18 ref|XP_010684772.1| PREDICTED: pentatricopeptide repeat-containi... 99 3e-18 ref|XP_014502580.1| PREDICTED: pentatricopeptide repeat-containi... 99 4e-18 gb|KQK11017.1| hypothetical protein BRADI_2g57630 [Brachypodium ... 99 4e-18 gb|EMT14531.1| hypothetical protein F775_12470 [Aegilops tauschii] 99 4e-18 ref|XP_003564838.1| PREDICTED: pentatricopeptide repeat-containi... 99 4e-18 ref|XP_009794453.1| PREDICTED: pentatricopeptide repeat-containi... 98 5e-18 >ref|XP_007025730.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] gi|508781096|gb|EOY28352.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] Length = 472 Score = 105 bits (261), Expect = 4e-20 Identities = 50/84 (59%), Positives = 67/84 (79%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC++EE DKAL LL EMK+ G+ + ++Y +I+SLCL LDW TAEKLL+EMK +G Sbjct: 381 IRGYCKIEEFDKALKLLAEMKDFGVQPNVDEYNKLIQSLCLKALDWQTAEKLLDEMKENG 440 Query: 560 MCLSGNSQGLIKAVKELQKEESEA 489 + L+G +QGLIKAVKEL+ EE ++ Sbjct: 441 LYLNGITQGLIKAVKELEAEEVDS 464 >ref|XP_007025729.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508781095|gb|EOY28351.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 569 Score = 105 bits (261), Expect = 4e-20 Identities = 50/84 (59%), Positives = 67/84 (79%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC++EE DKAL LL EMK+ G+ + ++Y +I+SLCL LDW TAEKLL+EMK +G Sbjct: 478 IRGYCKIEEFDKALKLLAEMKDFGVQPNVDEYNKLIQSLCLKALDWQTAEKLLDEMKENG 537 Query: 560 MCLSGNSQGLIKAVKELQKEESEA 489 + L+G +QGLIKAVKEL+ EE ++ Sbjct: 538 LYLNGITQGLIKAVKELEAEEVDS 561 >ref|XP_008218493.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Prunus mume] Length = 576 Score = 104 bits (260), Expect = 5e-20 Identities = 51/83 (61%), Positives = 67/83 (80%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LEE DK L LL EMK+SG+ + ++Y +I+SLCL LDW TAEKLLEEMK +G Sbjct: 486 IRGYCKLEEFDKGLKLLREMKDSGVQPNVDEYNKLIQSLCLKALDWETAEKLLEEMKDNG 545 Query: 560 MCLSGNSQGLIKAVKELQKEESE 492 + L+G ++GLIKAVKEL++E+ E Sbjct: 546 LHLNGITRGLIKAVKELKEEKIE 568 >ref|XP_007205009.1| hypothetical protein PRUPE_ppa003637mg [Prunus persica] gi|462400651|gb|EMJ06208.1| hypothetical protein PRUPE_ppa003637mg [Prunus persica] Length = 560 Score = 104 bits (260), Expect = 5e-20 Identities = 51/83 (61%), Positives = 67/83 (80%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LEE DK L LL EMK+SG+ + ++Y +I+SLCL LDW TAEKLLEEMK +G Sbjct: 470 IRGYCKLEEFDKGLKLLREMKDSGVQPNVDEYNKLIQSLCLKALDWETAEKLLEEMKDNG 529 Query: 560 MCLSGNSQGLIKAVKELQKEESE 492 + L+G ++GLIKAVKEL++E+ E Sbjct: 530 LHLNGITRGLIKAVKELKEEKIE 552 >ref|XP_010242491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Nelumbo nucifera] Length = 626 Score = 102 bits (254), Expect = 3e-19 Identities = 49/84 (58%), Positives = 68/84 (80%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LEE DKAL LL+EMK+ G+ + ++Y +I+SLCL LDW TAEKLL+EMK +G Sbjct: 536 IRGYCRLEEFDKALKLLSEMKKYGVQPNPDEYNKLIQSLCLKALDWETAEKLLQEMKENG 595 Query: 560 MCLSGNSQGLIKAVKELQKEESEA 489 + L+G ++GLI+AVKEL +EE ++ Sbjct: 596 LHLNGITRGLIRAVKELGEEELQS 619 >ref|XP_013461142.1| PPR containing plant protein [Medicago truncatula] gi|657394583|gb|KEH35176.1| PPR containing plant protein [Medicago truncatula] Length = 562 Score = 102 bits (253), Expect = 3e-19 Identities = 50/91 (54%), Positives = 66/91 (72%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LE D+AL LLTEMK+ G+ A ++Y+ +I+SLCL LDW AEKL EEMK G Sbjct: 472 IRGYCKLERFDEALELLTEMKDFGVRASADEYEKLIQSLCLKALDWEKAEKLQEEMKEKG 531 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L G ++ L++AVKE +KE EA ES+ A Sbjct: 532 LHLKGITRALVRAVKEAEKEAVEAQSESLVA 562 >emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] Length = 549 Score = 102 bits (253), Expect = 3e-19 Identities = 51/87 (58%), Positives = 68/87 (78%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LE+ DKA+ LL EMKE G+ + ++Y +I+SLCL LDW TAEKLLEEMK +G Sbjct: 459 IRGYCKLEQFDKAVELLGEMKEHGVQPNTDEYNKLIQSLCLKALDWQTAEKLLEEMKQNG 518 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQE 480 + L+G ++GLI+AVKEL+ EE A +E Sbjct: 519 LHLNGITRGLIRAVKELE-EEGRATEE 544 >gb|KOM46765.1| hypothetical protein LR48_Vigan07g046900 [Vigna angularis] Length = 548 Score = 100 bits (250), Expect = 8e-19 Identities = 52/91 (57%), Positives = 69/91 (75%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LE D+ALNL +EMK G+ + ++Y+ +I+SLCL LDW TAEKLLEEMK +G Sbjct: 458 IRGYCKLERFDEALNLFSEMKNYGVRPNVDEYEKLIQSLCLKALDWETAEKLLEEMKDNG 517 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L G ++GLI++VKEL+KE E ESI A Sbjct: 518 LHLKGITRGLIRSVKELEKEIVEG--ESITA 546 >ref|XP_006351118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Solanum tuberosum] Length = 595 Score = 100 bits (249), Expect = 1e-18 Identities = 48/81 (59%), Positives = 64/81 (79%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LE+ DKAL LL EMKE G+ + ++Y I+SLCL LDW TAEKLLEEMK +G Sbjct: 505 IRGYCKLEQYDKALELLGEMKEYGVQPNADEYNKFIQSLCLKALDWTTAEKLLEEMKENG 564 Query: 560 MCLSGNSQGLIKAVKELQKEE 498 + L+ ++GL++AVKEL++EE Sbjct: 565 VHLNAITKGLVRAVKELEQEE 585 >ref|XP_010088586.1| hypothetical protein L484_016979 [Morus notabilis] gi|587846207|gb|EXB36727.1| hypothetical protein L484_016979 [Morus notabilis] Length = 555 Score = 99.8 bits (247), Expect = 2e-18 Identities = 48/91 (52%), Positives = 68/91 (74%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LEE DKAL LL EM++ G+ + ++Y +I+SLCL LDW TAEKLL+EM G Sbjct: 465 IRGYCKLEEFDKALELLAEMEDHGVKPNVDEYNKLIQSLCLKALDWETAEKLLDEMNEKG 524 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L+G ++GLI+AVKE+ +EE E + ++ A Sbjct: 525 LHLNGITRGLIRAVKEMVEEEVETTKINVEA 555 >ref|XP_010917712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Elaeis guineensis] Length = 619 Score = 99.4 bits (246), Expect = 2e-18 Identities = 48/91 (52%), Positives = 66/91 (72%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC++EE +KAL L EMKE G+ + ++Y +I+SLCL LDW TAEKLLEEMK G Sbjct: 529 IRGYCKMEEFEKALECLKEMKEDGLQPNTDEYNKMIQSLCLKALDWRTAEKLLEEMKESG 588 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L G ++ LI A+KEL++EE ++ S+ A Sbjct: 589 LYLKGITRSLIAAIKELEEEEIQSKGASLQA 619 >gb|KHN32628.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 539 Score = 99.4 bits (246), Expect = 2e-18 Identities = 52/91 (57%), Positives = 66/91 (72%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LE+ D+AL LL EMK+ G+ N+Y +I+SLCL LDW AEKL EEMK G Sbjct: 449 IRGYCKLEQFDEALKLLAEMKDYGVRPSVNEYDKLIQSLCLKALDWEMAEKLQEEMKESG 508 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L G ++GLI+AVKE++KE EA ESI A Sbjct: 509 LHLKGITRGLIRAVKEMEKEVVEA--ESITA 537 >ref|XP_009408333.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Musa acuminata subsp. malaccensis] Length = 604 Score = 99.4 bits (246), Expect = 2e-18 Identities = 50/91 (54%), Positives = 65/91 (71%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC++EE DKALN L EMK+ G+ + ++Y +I++LCL +DW TAEKLLEEMK G Sbjct: 515 IRGYCKMEEYDKALNCLKEMKDYGVQPNADEYNKLIKTLCLKAVDWCTAEKLLEEMKESG 574 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L G ++ LI AVKEL E EA ES+ A Sbjct: 575 LFLKGTTRSLITAVKEL---EQEAQSESVHA 602 >ref|XP_008808558.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Phoenix dactylifera] Length = 535 Score = 99.4 bits (246), Expect = 2e-18 Identities = 48/91 (52%), Positives = 66/91 (72%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYCQ+EE +KAL + EMKE G+ + ++Y +I+SLCL LDW TAEKLL EMK G Sbjct: 445 IRGYCQMEEFEKALECMKEMKEDGLQPNTDEYNKMIQSLCLKALDWRTAEKLLAEMKESG 504 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L G ++GLI A+KEL++EE ++ S+ A Sbjct: 505 LHLKGITRGLIAAIKELEEEEIQSKGGSLQA 535 >ref|XP_010684772.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870853926|gb|KMT05759.1| hypothetical protein BVRB_7g166000 [Beta vulgaris subsp. vulgaris] Length = 594 Score = 99.0 bits (245), Expect = 3e-18 Identities = 48/87 (55%), Positives = 67/87 (77%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+L E DKAL LL+EMK+ G++ + ++Y +I++LCL +LDW TAEKLLEEMK G Sbjct: 504 IRGYCKLGEFDKALKLLSEMKDYGVVPNVDEYNKLIQTLCLESLDWKTAEKLLEEMKEKG 563 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQE 480 + L G ++GLI AVKEL++E + +E Sbjct: 564 LYLPGITRGLISAVKELEQEAVGSEKE 590 >ref|XP_014502580.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Vigna radiata var. radiata] Length = 542 Score = 98.6 bits (244), Expect = 4e-18 Identities = 51/91 (56%), Positives = 67/91 (73%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LE D+ALNL +EMK G+ ++Y+ +I+SLCL LDW TAEKL EEMK +G Sbjct: 452 IRGYCKLERFDEALNLFSEMKNYGVRPSVDEYEKLIQSLCLKALDWETAEKLHEEMKENG 511 Query: 560 MCLSGNSQGLIKAVKELQKEESEAPQESIAA 468 + L G ++GLI++VKEL+KE E ESI A Sbjct: 512 LHLKGITRGLIRSVKELEKEVVEG--ESITA 540 >gb|KQK11017.1| hypothetical protein BRADI_2g57630 [Brachypodium distachyon] Length = 541 Score = 98.6 bits (244), Expect = 4e-18 Identities = 48/89 (53%), Positives = 66/89 (74%), Gaps = 1/89 (1%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC++EE +KAL L EMKE G+ + ++Y +I+SLCL +DW TAEKLLEEM+ G Sbjct: 453 IRGYCKMEEFEKALECLNEMKEDGLQPNMDEYNKLIQSLCLKAMDWRTAEKLLEEMESSG 512 Query: 560 MCLSGNSQGLIKAVKELQKEE-SEAPQES 477 +CL G ++ L+ AVKEL+ EE S+ QE+ Sbjct: 513 LCLKGITRSLVAAVKELEMEEMSKDSQEA 541 >gb|EMT14531.1| hypothetical protein F775_12470 [Aegilops tauschii] Length = 565 Score = 98.6 bits (244), Expect = 4e-18 Identities = 46/82 (56%), Positives = 63/82 (76%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC++EE +KAL L EMKE G+ + ++Y ++I+SLCL ++DW TAEKLLEEM+ G Sbjct: 477 IRGYCKMEEFEKALECLKEMKEDGLQPNMDEYSELIQSLCLKSMDWRTAEKLLEEMEGSG 536 Query: 560 MCLSGNSQGLIKAVKELQKEES 495 +CL G + LI AVKEL+ EE+ Sbjct: 537 LCLKGIIRSLIPAVKELETEEA 558 >ref|XP_003564838.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Brachypodium distachyon] Length = 552 Score = 98.6 bits (244), Expect = 4e-18 Identities = 48/89 (53%), Positives = 66/89 (74%), Gaps = 1/89 (1%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC++EE +KAL L EMKE G+ + ++Y +I+SLCL +DW TAEKLLEEM+ G Sbjct: 464 IRGYCKMEEFEKALECLNEMKEDGLQPNMDEYNKLIQSLCLKAMDWRTAEKLLEEMESSG 523 Query: 560 MCLSGNSQGLIKAVKELQKEE-SEAPQES 477 +CL G ++ L+ AVKEL+ EE S+ QE+ Sbjct: 524 LCLKGITRSLVAAVKELEMEEMSKDSQEA 552 >ref|XP_009794453.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Nicotiana sylvestris] Length = 598 Score = 98.2 bits (243), Expect = 5e-18 Identities = 46/81 (56%), Positives = 64/81 (79%) Frame = -1 Query: 740 IRGYCQLEETDKALNLLTEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKVHG 561 IRGYC+LE+ +KA+ LL EMKE G+ + ++Y +I+SLCL LDW TAEKLLEEMK +G Sbjct: 508 IRGYCKLEQYEKAVELLGEMKEYGVQPNADEYNKLIQSLCLKALDWTTAEKLLEEMKENG 567 Query: 560 MCLSGNSQGLIKAVKELQKEE 498 + L+ ++GL++AVKEL+ EE Sbjct: 568 LHLNAITKGLVRAVKELEHEE 588