BLASTX nr result
ID: Papaver30_contig00023281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00023281 (1504 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK61873.1| F-box / LRR-repeat protein [Citrus unshiu] 56 2e-06 gb|KDO73620.1| hypothetical protein CISIN_1g001704mg [Citrus sin... 56 2e-06 ref|XP_006474491.1| PREDICTED: F-box/LRR-repeat protein 15-like ... 56 2e-06 ref|XP_006452999.1| hypothetical protein CICLE_v10007327mg [Citr... 56 2e-06 gb|KDO73622.1| hypothetical protein CISIN_1g001704mg [Citrus sin... 56 2e-06 gb|KDO73621.1| hypothetical protein CISIN_1g001704mg [Citrus sin... 56 2e-06 gb|KDO73623.1| hypothetical protein CISIN_1g001704mg [Citrus sin... 56 2e-06 ref|XP_010261911.1| PREDICTED: F-box/LRR-repeat protein 15-like ... 58 4e-06 gb|KHG08516.1| F-box/LRR-repeat 15 -like protein [Gossypium arbo... 54 9e-06 ref|XP_012487736.1| PREDICTED: F-box/LRR-repeat protein 15-like ... 54 9e-06 ref|XP_011102267.1| PREDICTED: F-box/LRR-repeat protein 15-like ... 53 9e-06 >dbj|BAK61873.1| F-box / LRR-repeat protein [Citrus unshiu] Length = 1068 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L +L L+C CL EV+L +CESL NS+ +FSD Sbjct: 589 QKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSD 630 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 632 GGCPMLKSLVLDNCE 646 >gb|KDO73620.1| hypothetical protein CISIN_1g001704mg [Citrus sinensis] Length = 1024 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L +L L+C CL EV+L +CESL NS+ +FSD Sbjct: 564 QKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSD 605 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 607 GGCPMLKSLVLDNCE 621 >ref|XP_006474491.1| PREDICTED: F-box/LRR-repeat protein 15-like [Citrus sinensis] Length = 1024 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L +L L+C CL EV+L +CESL NS+ +FSD Sbjct: 564 QKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSD 605 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 607 GGCPMLKSLVLDNCE 621 >ref|XP_006452999.1| hypothetical protein CICLE_v10007327mg [Citrus clementina] gi|557556225|gb|ESR66239.1| hypothetical protein CICLE_v10007327mg [Citrus clementina] Length = 1024 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L +L L+C CL EV+L +CESL NS+ +FSD Sbjct: 564 QKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSD 605 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 607 GGCPMLKSLVLDNCE 621 >gb|KDO73622.1| hypothetical protein CISIN_1g001704mg [Citrus sinensis] Length = 835 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L +L L+C CL EV+L +CESL NS+ +FSD Sbjct: 375 QKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSD 416 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 418 GGCPMLKSLVLDNCE 432 >gb|KDO73621.1| hypothetical protein CISIN_1g001704mg [Citrus sinensis] Length = 733 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L +L L+C CL EV+L +CESL NS+ +FSD Sbjct: 564 QKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSD 605 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 607 GGCPMLKSLVLDNCE 621 >gb|KDO73623.1| hypothetical protein CISIN_1g001704mg [Citrus sinensis] gi|641854830|gb|KDO73624.1| hypothetical protein CISIN_1g001704mg [Citrus sinensis] Length = 720 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L +L L+C CL EV+L +CESL NS+ +FSD Sbjct: 260 QKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSD 301 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 303 GGCPMLKSLVLDNCE 317 >ref|XP_010261911.1| PREDICTED: F-box/LRR-repeat protein 15-like [Nelumbo nucifera] gi|720018811|ref|XP_010261912.1| PREDICTED: F-box/LRR-repeat protein 15-like [Nelumbo nucifera] Length = 1033 Score = 57.8 bits (138), Expect(2) = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE+L TL L+C CL EV+L CESL NS+ +FSD Sbjct: 574 QKLVLQKQESLTTLALQCQCLQEVDLTRCESLTNSVCEVFSD 615 Score = 22.3 bits (46), Expect(2) = 4e-06 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LD+CE Sbjct: 617 GGCPMLRSLILDSCE 631 >gb|KHG08516.1| F-box/LRR-repeat 15 -like protein [Gossypium arboreum] Length = 1009 Score = 54.3 bits (129), Expect(2) = 9e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L L L+C CL EV+L +C SL NSI +FSD Sbjct: 553 QKLALQKQENLTMLALQCQCLQEVDLTDCASLTNSICNVFSD 594 Score = 24.6 bits (52), Expect(2) = 9e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 596 GGCPMLKSLVLDNCE 610 >ref|XP_012487736.1| PREDICTED: F-box/LRR-repeat protein 15-like [Gossypium raimondii] gi|763739901|gb|KJB07400.1| hypothetical protein B456_001G020200 [Gossypium raimondii] gi|763739902|gb|KJB07401.1| hypothetical protein B456_001G020200 [Gossypium raimondii] Length = 1005 Score = 54.3 bits (129), Expect(2) = 9e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFSD 51 QKL LQKQE L L L+C CL EV+L +C SL NSI +FSD Sbjct: 549 QKLALQKQENLTMLALQCQCLQEVDLTDCASLTNSICNVFSD 590 Score = 24.6 bits (52), Expect(2) = 9e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C +L SL LDNCE Sbjct: 592 GGCPMLKSLVLDNCE 606 >ref|XP_011102267.1| PREDICTED: F-box/LRR-repeat protein 15-like [Sesamum indicum] Length = 970 Score = 53.1 bits (126), Expect(2) = 9e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 176 QKLWLQKQETLKTLVLKCNCLPEVELNNCESLMNSIYGIFS 54 +KL+LQKQE+L L L+C+CL EV+L CESL NSI +FS Sbjct: 510 KKLFLQKQESLTMLELQCHCLEEVDLTECESLTNSICEVFS 550 Score = 25.8 bits (55), Expect(2) = 9e-06 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 48 GDCTVL*SLALDNCE 4 G C VL SL LDNCE Sbjct: 553 GGCPVLRSLVLDNCE 567