BLASTX nr result
ID: Papaver30_contig00022949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00022949 (537 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009367255.1| PREDICTED: mediator of RNA polymerase II tra... 84 3e-17 gb|KHN01307.1| hypothetical protein glysoja_009513 [Glycine soja] 80 4e-17 gb|KRH47405.1| hypothetical protein GLYMA_07G027800 [Glycine max] 80 4e-17 ref|XP_010244438.1| PREDICTED: mediator of RNA polymerase II tra... 80 1e-16 ref|XP_009616506.1| PREDICTED: mediator of RNA polymerase II tra... 81 2e-16 ref|XP_009616513.1| PREDICTED: mediator of RNA polymerase II tra... 81 2e-16 ref|XP_009616519.1| PREDICTED: mediator of RNA polymerase II tra... 81 2e-16 ref|XP_009616527.1| PREDICTED: mediator of RNA polymerase II tra... 81 2e-16 ref|XP_004486632.1| PREDICTED: mediator of RNA polymerase II tra... 89 1e-15 ref|XP_003597962.2| mediator of RNA polymerase II transcription ... 88 2e-15 ref|XP_010057608.1| PREDICTED: mediator of RNA polymerase II tra... 78 2e-15 ref|XP_010057607.1| PREDICTED: mediator of RNA polymerase II tra... 78 2e-15 ref|XP_010057606.1| PREDICTED: mediator of RNA polymerase II tra... 78 2e-15 ref|XP_010057610.1| PREDICTED: mediator of RNA polymerase II tra... 78 2e-15 ref|XP_010057609.1| PREDICTED: mediator of RNA polymerase II tra... 78 2e-15 ref|XP_010057617.1| PREDICTED: mediator of RNA polymerase II tra... 78 2e-15 gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] 88 3e-15 ref|XP_010245151.1| PREDICTED: mediator of RNA polymerase II tra... 75 4e-15 ref|XP_003597959.2| transcription cofactor, putative [Medicago t... 87 4e-15 ref|XP_013465575.1| transcription cofactor, putative [Medicago t... 87 4e-15 >ref|XP_009367255.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like [Pyrus x bretschneideri] Length = 1361 Score = 84.0 bits (206), Expect(2) = 3e-17 Identities = 37/67 (55%), Positives = 51/67 (76%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IKSM+E Y P+L + +QKI+ K QQHDSLP PKSEQ+E+LK+FK ML+++++ L PKS Sbjct: 608 IKSMKELYFPELSEMYQKIATKLQQHDSLPQQPKSEQLEKLKMFKTMLERLISVLQFPKS 667 Query: 355 SAIPSLK 335 + P K Sbjct: 668 NITPGFK 674 Score = 31.2 bits (69), Expect(2) = 3e-17 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRK 273 F+ KL EK I+N +N+NRPRK Sbjct: 673 FKEKLGTYEKQIVNFINTNRPRK 695 >gb|KHN01307.1| hypothetical protein glysoja_009513 [Glycine soja] Length = 1248 Score = 80.5 bits (197), Expect(2) = 4e-17 Identities = 32/67 (47%), Positives = 54/67 (80%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +++M+E YLP++ + +QKI+ K QQHDSLP PKS+QI++L+ +K ML++M+A L +PK+ Sbjct: 537 LQTMKESYLPEMNEMYQKIANKLQQHDSLPQQPKSDQIDKLRAYKTMLERMMALLQIPKN 596 Query: 355 SAIPSLK 335 + +P+ K Sbjct: 597 NILPNFK 603 Score = 33.9 bits (76), Expect(2) = 4e-17 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRK 273 F+ KL + EK I+N++NSNRPRK Sbjct: 602 FKEKLGSYEKQIINLINSNRPRK 624 >gb|KRH47405.1| hypothetical protein GLYMA_07G027800 [Glycine max] Length = 1062 Score = 80.5 bits (197), Expect(2) = 4e-17 Identities = 32/67 (47%), Positives = 54/67 (80%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +++M+E YLP++ + +QKI+ K QQHDSLP PKS+QI++L+ +K ML++M+A L +PK+ Sbjct: 542 LQTMKESYLPEMNEMYQKIANKLQQHDSLPQQPKSDQIDKLRAYKTMLERMMALLQIPKN 601 Query: 355 SAIPSLK 335 + +P+ K Sbjct: 602 NILPNFK 608 Score = 33.9 bits (76), Expect(2) = 4e-17 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRK 273 F+ KL + EK I+N++NSNRPRK Sbjct: 607 FKEKLGSYEKQIINLINSNRPRK 629 >ref|XP_010244438.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like [Nelumbo nucifera] Length = 1410 Score = 79.7 bits (195), Expect(2) = 1e-16 Identities = 33/63 (52%), Positives = 51/63 (80%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IK+M+E YLP++ + +QKI+ KC Q+DSLP PP SE I RLK+FKN+L++++ FL +PK+ Sbjct: 619 IKAMKEMYLPEINEMYQKIALKCHQNDSLPQPPNSEHINRLKMFKNVLERIINFLQVPKA 678 Query: 355 SAI 347 + + Sbjct: 679 NCL 681 Score = 33.1 bits (74), Expect(2) = 1e-16 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKP 270 ++ K+ EK I NILN+NRP+KP Sbjct: 683 YKDKMAGFEKQITNILNTNRPKKP 706 >ref|XP_009616506.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X1 [Nicotiana tomentosiformis] Length = 1358 Score = 80.9 bits (198), Expect(2) = 2e-16 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IKSMRE YLP+L D +QKI+ K QQHDSLP P++EQIE+LK+FK L+++V FL L K Sbjct: 619 IKSMREMYLPELNDLYQKIAAKVQQHDSLPQRPQTEQIEKLKVFKMTLERVVLFLRLNKH 678 Query: 355 SAIPSLK 335 PS K Sbjct: 679 DIQPSHK 685 Score = 31.2 bits (69), Expect(2) = 2e-16 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 320 VEKHILNILNSNRPRKP 270 +EKHI LNSNRPRKP Sbjct: 691 IEKHISFFLNSNRPRKP 707 >ref|XP_009616513.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X2 [Nicotiana tomentosiformis] Length = 1355 Score = 80.9 bits (198), Expect(2) = 2e-16 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IKSMRE YLP+L D +QKI+ K QQHDSLP P++EQIE+LK+FK L+++V FL L K Sbjct: 616 IKSMREMYLPELNDLYQKIAAKVQQHDSLPQRPQTEQIEKLKVFKMTLERVVLFLRLNKH 675 Query: 355 SAIPSLK 335 PS K Sbjct: 676 DIQPSHK 682 Score = 31.2 bits (69), Expect(2) = 2e-16 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 320 VEKHILNILNSNRPRKP 270 +EKHI LNSNRPRKP Sbjct: 688 IEKHISFFLNSNRPRKP 704 >ref|XP_009616519.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X3 [Nicotiana tomentosiformis] Length = 1326 Score = 80.9 bits (198), Expect(2) = 2e-16 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IKSMRE YLP+L D +QKI+ K QQHDSLP P++EQIE+LK+FK L+++V FL L K Sbjct: 619 IKSMREMYLPELNDLYQKIAAKVQQHDSLPQRPQTEQIEKLKVFKMTLERVVLFLRLNKH 678 Query: 355 SAIPSLK 335 PS K Sbjct: 679 DIQPSHK 685 Score = 31.2 bits (69), Expect(2) = 2e-16 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 320 VEKHILNILNSNRPRKP 270 +EKHI LNSNRPRKP Sbjct: 691 IEKHISFFLNSNRPRKP 707 >ref|XP_009616527.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X4 [Nicotiana tomentosiformis] Length = 1199 Score = 80.9 bits (198), Expect(2) = 2e-16 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IKSMRE YLP+L D +QKI+ K QQHDSLP P++EQIE+LK+FK L+++V FL L K Sbjct: 619 IKSMREMYLPELNDLYQKIAAKVQQHDSLPQRPQTEQIEKLKVFKMTLERVVLFLRLNKH 678 Query: 355 SAIPSLK 335 PS K Sbjct: 679 DIQPSHK 685 Score = 31.2 bits (69), Expect(2) = 2e-16 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 320 VEKHILNILNSNRPRKP 270 +EKHI LNSNRPRKP Sbjct: 691 IEKHISFFLNSNRPRKP 707 >ref|XP_004486632.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a [Cicer arietinum] Length = 1313 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/67 (58%), Positives = 55/67 (82%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IK+M+E YLP+L + +QKI+ K QQHDSLPH PKS+Q+E+LK+FK ML++++ FL + KS Sbjct: 564 IKAMKESYLPELSEMYQKIAAKLQQHDSLPHQPKSDQLEKLKVFKLMLERLITFLQVSKS 623 Query: 355 SAIPSLK 335 + PSLK Sbjct: 624 NISPSLK 630 >ref|XP_003597962.2| mediator of RNA polymerase II transcription subunit 15a, putative [Medicago truncatula] gi|657400417|gb|AES68213.2| mediator of RNA polymerase II transcription subunit 15a, putative [Medicago truncatula] Length = 241 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/67 (61%), Positives = 54/67 (80%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IK+M+E YLP+L +QKI+ K QQHDSLPH PKS+QIE+LK+FK MLD+++ FL + KS Sbjct: 23 IKAMKESYLPELNWMYQKIATKLQQHDSLPHQPKSDQIEKLKVFKMMLDRLLTFLQVSKS 82 Query: 355 SAIPSLK 335 S P+LK Sbjct: 83 SISPNLK 89 >ref|XP_010057608.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X3 [Eucalyptus grandis] Length = 684 Score = 77.8 bits (190), Expect(2) = 2e-15 Identities = 35/67 (52%), Positives = 53/67 (79%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +KSMR+ YLP+L + +QKIS K QQH+SLP PKS+Q+++LK FK ML++++A L++ K+ Sbjct: 364 MKSMRDTYLPELNEMYQKISMKLQQHESLPLQPKSDQLDKLKNFKLMLERVIAILHVNKA 423 Query: 355 SAIPSLK 335 +PS K Sbjct: 424 DIVPSFK 430 Score = 30.8 bits (68), Expect(2) = 2e-15 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKPA 267 F+ KL + EK I+N +N++RPRK A Sbjct: 429 FKEKLVSFEKQIINFINTSRPRKVA 453 >ref|XP_010057607.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X2 [Eucalyptus grandis] Length = 684 Score = 77.8 bits (190), Expect(2) = 2e-15 Identities = 35/67 (52%), Positives = 53/67 (79%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +KSMR+ YLP+L + +QKIS K QQH+SLP PKS+Q+++LK FK ML++++A L++ K+ Sbjct: 364 MKSMRDTYLPELNEMYQKISMKLQQHESLPLQPKSDQLDKLKNFKLMLERVIAILHVNKA 423 Query: 355 SAIPSLK 335 +PS K Sbjct: 424 DIVPSFK 430 Score = 30.8 bits (68), Expect(2) = 2e-15 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKPA 267 F+ KL + EK I+N +N++RPRK A Sbjct: 429 FKEKLVSFEKQIINFINTSRPRKVA 453 >ref|XP_010057606.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X1 [Eucalyptus grandis] Length = 684 Score = 77.8 bits (190), Expect(2) = 2e-15 Identities = 35/67 (52%), Positives = 53/67 (79%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +KSMR+ YLP+L + +QKIS K QQH+SLP PKS+Q+++LK FK ML++++A L++ K+ Sbjct: 364 MKSMRDTYLPELNEMYQKISMKLQQHESLPLQPKSDQLDKLKNFKLMLERVIAILHVNKA 423 Query: 355 SAIPSLK 335 +PS K Sbjct: 424 DIVPSFK 430 Score = 30.8 bits (68), Expect(2) = 2e-15 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKPA 267 F+ KL + EK I+N +N++RPRK A Sbjct: 429 FKEKLVSFEKQIINFINTSRPRKVA 453 >ref|XP_010057610.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X5 [Eucalyptus grandis] Length = 683 Score = 77.8 bits (190), Expect(2) = 2e-15 Identities = 35/67 (52%), Positives = 53/67 (79%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +KSMR+ YLP+L + +QKIS K QQH+SLP PKS+Q+++LK FK ML++++A L++ K+ Sbjct: 363 MKSMRDTYLPELNEMYQKISMKLQQHESLPLQPKSDQLDKLKNFKLMLERVIAILHVNKA 422 Query: 355 SAIPSLK 335 +PS K Sbjct: 423 DIVPSFK 429 Score = 30.8 bits (68), Expect(2) = 2e-15 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKPA 267 F+ KL + EK I+N +N++RPRK A Sbjct: 428 FKEKLVSFEKQIINFINTSRPRKVA 452 >ref|XP_010057609.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349745|ref|XP_010057611.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349752|ref|XP_010057612.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349759|ref|XP_010057613.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349766|ref|XP_010057615.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] gi|702349773|ref|XP_010057616.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Eucalyptus grandis] Length = 683 Score = 77.8 bits (190), Expect(2) = 2e-15 Identities = 35/67 (52%), Positives = 53/67 (79%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +KSMR+ YLP+L + +QKIS K QQH+SLP PKS+Q+++LK FK ML++++A L++ K+ Sbjct: 363 MKSMRDTYLPELNEMYQKISMKLQQHESLPLQPKSDQLDKLKNFKLMLERVIAILHVNKA 422 Query: 355 SAIPSLK 335 +PS K Sbjct: 423 DIVPSFK 429 Score = 30.8 bits (68), Expect(2) = 2e-15 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKPA 267 F+ KL + EK I+N +N++RPRK A Sbjct: 428 FKEKLVSFEKQIINFINTSRPRKVA 452 >ref|XP_010057617.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X6 [Eucalyptus grandis] Length = 652 Score = 77.8 bits (190), Expect(2) = 2e-15 Identities = 35/67 (52%), Positives = 53/67 (79%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 +KSMR+ YLP+L + +QKIS K QQH+SLP PKS+Q+++LK FK ML++++A L++ K+ Sbjct: 364 MKSMRDTYLPELNEMYQKISMKLQQHESLPLQPKSDQLDKLKNFKLMLERVIAILHVNKA 423 Query: 355 SAIPSLK 335 +PS K Sbjct: 424 DIVPSFK 430 Score = 30.8 bits (68), Expect(2) = 2e-15 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKPA 267 F+ KL + EK I+N +N++RPRK A Sbjct: 429 FKEKLVSFEKQIINFINTSRPRKVA 453 >gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] Length = 1405 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/67 (58%), Positives = 55/67 (82%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IKSM+E YLP+L + +QKI+ K QQHDSLP PKS+Q+E+LKIFK ML+++++FL + KS Sbjct: 623 IKSMKEMYLPELNEMYQKIAAKLQQHDSLPQQPKSDQLEKLKIFKTMLERIISFLQVSKS 682 Query: 355 SAIPSLK 335 + +PS K Sbjct: 683 NILPSFK 689 >ref|XP_010245151.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X1 [Nelumbo nucifera] gi|720090613|ref|XP_010245152.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a isoform X1 [Nelumbo nucifera] Length = 1422 Score = 75.5 bits (184), Expect(2) = 4e-15 Identities = 30/63 (47%), Positives = 52/63 (82%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IKSM+E YLP++ + +QKI+ KCQQ+DSLP P KS+ ++RL++F+ ML++++ FL++ K+ Sbjct: 630 IKSMKEMYLPEINEMYQKIALKCQQNDSLPQPQKSDHVDRLRMFRTMLERIIQFLSVAKT 689 Query: 355 SAI 347 + + Sbjct: 690 TCL 692 Score = 32.3 bits (72), Expect(2) = 4e-15 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = -2 Query: 341 FEGKLEAVEKHILNILNSNRPRKP 270 ++ KL +EK I+ +LN+NRP+KP Sbjct: 694 YKDKLPLLEKQIVGVLNTNRPKKP 717 >ref|XP_003597959.2| transcription cofactor, putative [Medicago truncatula] gi|657400416|gb|AES68210.2| transcription cofactor, putative [Medicago truncatula] Length = 529 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/67 (58%), Positives = 54/67 (80%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IK M+E YLP+L + +QKI+ K QQHDSLPH PKS+Q+E+LK+FK ML++++ FL + KS Sbjct: 246 IKVMKESYLPELNEMYQKIATKLQQHDSLPHQPKSDQLEKLKVFKLMLERLITFLQVSKS 305 Query: 355 SAIPSLK 335 + PSLK Sbjct: 306 NISPSLK 312 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/67 (52%), Positives = 49/67 (73%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IK+M+E YLP L + QKI+ K QQHDSLP PKS+++E LK FK +L++++ FL + KS Sbjct: 133 IKAMKESYLPKLSEMIQKIATKLQQHDSLPQQPKSDELEMLKEFKMVLERLITFLQVSKS 192 Query: 355 SAIPSLK 335 + P LK Sbjct: 193 NISPCLK 199 >ref|XP_013465575.1| transcription cofactor, putative [Medicago truncatula] gi|657400415|gb|KEH39611.1| transcription cofactor, putative [Medicago truncatula] Length = 1252 Score = 87.4 bits (215), Expect = 4e-15 Identities = 38/67 (56%), Positives = 54/67 (80%) Frame = -3 Query: 535 IKSMREKYLPDLIDFHQKISRKCQQHDSLPHPPKSEQIERLKIFKNMLDKMVAFLNLPKS 356 IK+M+E YLP+L + +QKI+ K QHDSLPH PKS+Q+E+LK+FK ML++++ FL + KS Sbjct: 510 IKAMKESYLPELSEMYQKIATKLHQHDSLPHQPKSDQLEKLKVFKMMLERLITFLQVSKS 569 Query: 355 SAIPSLK 335 + PSLK Sbjct: 570 NISPSLK 576