BLASTX nr result
ID: Papaver30_contig00022230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00022230 (459 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267140.1| PREDICTED: cytochrome b5 [Nelumbo nucifera] ... 60 6e-07 >ref|XP_010267140.1| PREDICTED: cytochrome b5 [Nelumbo nucifera] gi|720035763|ref|XP_010267141.1| PREDICTED: cytochrome b5 [Nelumbo nucifera] Length = 117 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/54 (53%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = -3 Query: 157 MMIIIATVILGILYGAYLLMPQGRKPG--KVVAVKSNAKESKLYTREEIALHNK 2 M+I++ T++LG+L G +LL P+ RKPG KV N K SKLYTR E++LHNK Sbjct: 1 MVIVVLTLVLGVLLGVFLLTPRVRKPGNAKVAKAVLNNKASKLYTRAEVSLHNK 54