BLASTX nr result
ID: Papaver30_contig00021638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00021638 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515963.1| DNA repair/transcription protein met18/mms19... 54 2e-06 ref|XP_010249497.1| PREDICTED: MMS19 nucleotide excision repair ... 54 2e-06 >ref|XP_002515963.1| DNA repair/transcription protein met18/mms19, putative [Ricinus communis] gi|223544868|gb|EEF46383.1| DNA repair/transcription protein met18/mms19, putative [Ricinus communis] Length = 1174 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 115 VRVMKAITSAFDDPKRVVHQEAARCRHAWASLASGSTCY 231 ++V++AI+ A DDPKR V QEA RCR AWAS+AS S Y Sbjct: 1136 IQVLQAISKALDDPKRAVRQEAVRCRQAWASIASRSLHY 1174 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 3 LPHTRNYPMRPQV 41 LPHTR YP+R QV Sbjct: 1126 LPHTRIYPVRIQV 1138 >ref|XP_010249497.1| PREDICTED: MMS19 nucleotide excision repair protein homolog [Nelumbo nucifera] gi|719979495|ref|XP_010249498.1| PREDICTED: MMS19 nucleotide excision repair protein homolog [Nelumbo nucifera] Length = 1160 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 118 RVMKAITSAFDDPKRVVHQEAARCRHAWASLASGS 222 +V++AI+ A DDPKRVV QEA RCR AWAS+AS S Sbjct: 1123 QVLRAISKALDDPKRVVRQEAVRCRQAWASMASRS 1157 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 3 LPHTRNYPMRPQV 41 LPH R YPMR QV Sbjct: 1112 LPHVRIYPMRTQV 1124